KEGG   Treponema sp. OMZ 804: GWP43_05315
Entry
GWP43_05315       CDS       T06435                                 

Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00030  Pentose phosphate pathway
trz00500  Starch and sucrose metabolism
trz00520  Amino sugar and nucleotide sugar metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
Module
trz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_05315
   00030 Pentose phosphate pathway
    GWP43_05315
   00500 Starch and sucrose metabolism
    GWP43_05315
   00520 Amino sugar and nucleotide sugar metabolism
    GWP43_05315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:trz04147]
    GWP43_05315
Enzymes [BR:trz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     GWP43_05315
Exosome [BR:trz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GWP43_05315
  Exosomal proteins of other body fluids (saliva and urine)
   GWP43_05315
  Exosomal proteins of colorectal cancer cells
   GWP43_05315
SSDB
Motif
Pfam: PGI CamS
Other DBs
NCBI-ProteinID: QHX42957
UniProt: A0A6P1XZQ3
LinkDB
Position
complement(1113144..1114718)
AA seq 524 aa
MWKNLDECSLFRDLQEAQIPDLRQCLKGESGANRIERYSIPMAAGMHYNYAAKQVDDTLL
SLLQKLADEQQLILKYQQLLEGEEVNTGEHRKVLHHLTRGQLGDDVIYNGKNMRTFYLEQ
QKKVREFSEAIRNGSITAPSGKPFTDVVQIGIGGSDLGPRALYLALKAWGERHNKLKLRA
HFISNVDPDDAAAVLSALDLSTTLFILVSKSGTTLETLTNERFVGQFLQEAGLNPAKQMV
AVTSESSPLANNPSYLASFYMDDFIGGRYSSTSVCGGAVLSLAFGADTFDVLLAGATAAD
KQALDPSHTENAALMDALIGVYERNILGYGSTAILPYSQALSRFPAHLQQLDMESNGKSV
NRFGKLVHYKTGPVIFGEPGTNGQHSFYQLLHQGADIVPLQFIGFEESQYGKDITVEGST
SQQKLLANVAAQITAFALGKQDENANKSFAGGRPSSLIYGKALTPEALGALLAHYENKVM
FQGFIWNVNSFDQEGVQLGKVLAKKVLSHDMPPELAAYARLFGL
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtggaaaaatttagacgaatgttccctgtttcgagatttacaggaagcacaaatacct
gatctaagacagtgcctgaaaggagagagcggagcaaaccgaatcgagcgatactccata
ccgatggctgccggtatgcactacaattacgcggctaaacaggttgacgatacactattg
tctttacttcaaaaactcgcagacgaacagcagctgatactaaaatatcaacagctgctt
gaaggcgaagaagtcaatacgggagaacaccggaaagttctgcatcatctgacacgcgga
cagcttggcgacgatgttatctacaacggcaaaaatatgcgtaccttttatttggaacaa
cagaagaaagtccgtgagttttccgaagctatcagaaacggttccattaccgctccgtcc
ggtaagcctttcaccgatgttgtacagatcggtatcggcggttcggatctcggcccgcgc
gcgttgtaccttgcgctaaaagcatggggggagcggcataacaagctcaaactccgcgct
cactttatatcgaatgtagaccctgacgatgcggcggcagtactttccgcgctggattta
tcgacaacgctgtttatcttggtttcaaagagcggtaccacgctcgaaacgctcaccaat
gagcgcttcgtcgggcaatttttgcaggaggcgggactaaaccctgcaaagcaaatggtt
gccgtaacgagcgaaagcagtccgcttgccaacaatccttcatacctcgcatccttctat
atggatgactttatcggcgggcggtactcttccacctctgtatgcggaggtgcggtgctt
tcgttggcattcggagcagatacctttgacgtcctcctcgccggagccaccgcagcggac
aagcaagccctcgatccgagccataccgaaaatgccgccctcatggatgcgctgatcggt
gtctatgaacggaatatcctcggctacggcagcaccgctattctgccctacagccaagcg
ctttcccgcttccctgctcatctgcagcagctcgacatggaatccaacggaaagtcggtg
aaccgcttcggcaaactggttcactataaaacagggccggttatctttggggaaccggga
accaacgggcagcactcgttctatcagctgctgcaccaaggcgccgatattgtgccgctc
cagtttatcggctttgaagaaagtcaatacggcaaagacattaccgtggaaggttccacc
agtcagcaaaagctgcttgccaatgtcgccgcgcagataacggcctttgcgctcggtaaa
caggatgaaaatgcgaataagagctttgccggagggcggccttcaagccttatctacgga
aaggcgcttacgccggaagcgctcggtgcgctgcttgcacactacgaaaacaaggttatg
tttcaaggctttatctggaatgtcaacagctttgatcaagaaggggttcagctcggtaag
gtgcttgccaaaaaagtcttatcgcacgatatgccgcccgaactcgccgcctacgcccgc
ctcttcggactatag

DBGET integrated database retrieval system