KEGG   Treponema sp. OMZ 804: GWP43_05355
Entry
GWP43_05355       CDS       T06435                                 

Definition
(GenBank) pyruvate, phosphate dikinase
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00620  Pyruvate metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_05355
   00620 Pyruvate metabolism
    GWP43_05355
Enzymes [BR:trz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.1  pyruvate, phosphate dikinase
     GWP43_05355
SSDB
Motif
Pfam: PEP-utilizers_C PEP-utilizers PPDK_N
Other DBs
NCBI-ProteinID: QHX42965
UniProt: A0A6P1Y024
LinkDB
Position
complement(1124289..1126967)
AA seq 892 aa
MNMSKSIHFFSNKETLKSNIDKTLLGIRGRQLNEFSELGLPIVPGLVMDATITQTLQQAN
VLSPLRPFLKKMGEAVKKEFGDPENPLLLKLVISPNLVIANYPTLHNFGLAKTTIGGFEK
KVGTDFASHEVLFLLRGIFSILFKIAELQEDNAKQHLYKEQLEKIESELKKEKRNESGTT
VMDKYQPYLPQEFFSTAEVQLNQTIQLISTLLSLEPDNENDVALLIQPLVYGNYDKESFS
GRFFSRNIVTGEKKLQGMFFQEKFDEVDALGKDINDIKPVYLEQLEAIAWRLEDHSKDVR
EIRFTIEAGKLWLIEQKSVEAKSTIALVHFLLDLYNRKIVDAEYVVKNVKPGQLNEILHP
VINMTSVKNLQHSKGGIAGAPGAAVGRVYFSADALIEAQHIARLQSADTRCILCVPASYA
GDVKAIEVSTGVLSNEGGYSAHASVVSRQYGKISLVRPDMKIMANKAIINGITIKEGDYI
TLQVPYYGESTVYFGAAELIEPDPKTSGLLDFIDLTRSFIQDFHVRANADSPRDAALAVS
FGAEGIGLCRTEHMFFETKRINPFREMILSETTEERIKVLNKLQKVQMEDFYGIFKTMAG
REVTIRLLDAPLHEFLPHNDTELNEFIEHLKKETKKTVTKKALLEKIELCAEVNPMLGHR
GCRIAISYPEIYAMQIRAIFEAAYKLQKEGVETHVEIMVPIVMNFRELKQIAYGKKIEGH
AYLGIRTIEQEMRAQFKAKPIDFKIGTMIELPVAALSAGEIARYAEFFSFGTNDLTQTTL
GLSRDDFNSFMPDYTLYDLIDGNPFAILDPGVRELISIAIERGKLTRPDIKLGLCGEQGA
RPENIPFCMKAGLNYVSCSSYSVPIALLSIAQAELEKAENEGRKLTRKAVSR
NT seq 2679 nt   +upstreamnt  +downstreamnt
atgaatatgtctaaatcgatccattttttcagtaataaagaaacacttaaaagtaatatt
gacaaaacgctcctcggtattcgcgggcgccaactgaatgaattttcggaactcggatta
cctatcgtaccgggtcttgtcatggatgcaactattacacaaaccttgcaacaggcaaat
gtgctatcgccactgcggccgttcttaaagaaaatgggcgaagcggttaaaaaagaattc
ggtgatccggaaaatcctcttttattaaagctcgttatttcgcccaaccttgttatcgcc
aactatccgacgctccataacttcgggttggcaaaaacaaccatcggcggctttgaaaag
aaagtcggaacagattttgcaagtcacgaagttctgttcttattgcgcggtatcttttca
attttatttaagattgcagagttacaggaagacaacgcaaaacagcacctctataaagaa
cagctggaaaaaattgaaagtgaactgaagaaagaaaaacgaaacgaatccggtactacc
gttatggataagtaccaaccgtatctgccgcaagaattttttagcaccgcagaagtacag
ctcaatcaaaccatccagctcatcagcaccctgctcagtcttgaacctgataatgaaaat
gatgtcgcattattgattcagcccttagtatacggtaactatgacaaggaatccttttcc
ggcagattcttcagccgcaatatcgttaccggtgaaaagaaattacagggtatgttcttc
caagaaaaatttgatgaagtggatgccctcggaaaagatattaacgacataaagccggta
taccttgagcaattggaagctattgcatggcggttggaagatcatagtaaagatgtccgc
gaaatccggtttacgattgaagcaggaaaactatggcttatcgagcaaaaatccgttgaa
gcaaaaagcacgattgcattggtacacttcctcctcgatttatacaatcgaaaaatcgtt
gatgctgaatatgtcgtaaaaaatgtcaagcccggacagttaaatgaaatactgcatcct
gttatcaatatgacgagcgtcaaaaatctccagcattcaaagggcggtatcgcaggcgcg
ccgggtgcggcagtcggccgtgtatactttagtgctgacgcactgattgaagcccagcat
attgcacgtttgcaaagtgccgacacccgctgtattctctgcgtaccggcaagttatgca
ggcgatgtaaaggcgattgaagtttctaccggcgttttatcgaatgaaggcggctattcg
gcacatgcctccgttgtttcacgtcagtatgggaaaatctcgttggtacgccccgacatg
aaaattatggcgaataaagctatcatcaacggtattaccattaaggaaggggattacatc
accttgcaagtaccctactacggcgaatcgaccgtatacttcggagcggcagaactgatc
gaacctgatcccaaaacctccggcttgcttgactttatcgatcttacccgttcgtttatc
caagacttccatgtccgtgccaatgccgacagtccccgcgatgctgccttagcagtcagc
tttggcgctgaaggtatcgggctgtgccgtaccgaacacatgttctttgaaacaaaacgt
atcaatccctttagagagatgatcctttccgaaacaacggaagagcgtattaaagtttta
aacaagctccaaaaagtccaaatggaagacttttacggtatctttaagactatggcagga
cgtgaagttaccatccgcctgttagatgcgccgttacacgaattcttaccgcataatgat
acggaactgaacgaatttatcgaacatcttaaaaaagagaccaaaaagaccgttactaaa
aaagcattgttggaaaaaatcgaactttgtgcggaagtaaaccccatgctgggacaccga
ggctgccgtatcgcaatctcgtatcctgaaatttacgcaatgcaaatccgcgctatcttt
gaagcagcctacaaactgcaaaaagaaggcgttgaaacgcacgttgaaatcatggttccg
attgtcatgaacttccgtgagctcaagcaaattgcatacggaaagaagatcgaaggacat
gcctacctcggtatccgtacgattgaacaggaaatgcgtgcacagttcaaagcaaaaccg
atagacttcaaaatcggcacgatgattgaattgcccgttgcggccttatctgcaggagaa
attgcccgctatgcggaattcttctcgttcggaaccaatgaccttacgcaaacgacgctc
ggactttcccgcgatgactttaacagctttatgccggattacacgttgtatgacttaatc
gacggcaatccttttgcgattttggatccgggtgtgcgggaacttatcagtatcgcaatt
gaacgcggcaagctcacccgccccgacattaaactcggactctgcggagaacaaggcgca
cgccccgaaaacatccccttctgtatgaaggcaggtttgaactatgtttcctgttcgtct
tattcggtgccgatcgcacttttgtcgattgcacaggcagaattggaaaaggcggaaaac
gaagggcgtaagctcacgcgtaaagcagtttcaaggtaa

KEGG   Treponema sp. OMZ 804: GWP43_09830
Entry
GWP43_09830       CDS       T06435                                 

Definition
(GenBank) pyruvate, phosphate dikinase
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00620  Pyruvate metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_09830
   00620 Pyruvate metabolism
    GWP43_09830
Enzymes [BR:trz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.1  pyruvate, phosphate dikinase
     GWP43_09830
SSDB
Motif
Pfam: PEP-utilizers_C PPDK_N PEP-utilizers Fe_dep_repress
Other DBs
NCBI-ProteinID: QHX43684
UniProt: A0A6P1Y2H1
LinkDB
Position
complement(2094887..2097649)
AA seq 920 aa
MAEEKYVYFFGNGKAEGNGEMKQLLGGKGAGLAEMTRAKLPVPAGFTITTEVCQLYYSNN
KKYPAGLEQSVKENLAKLEKSAGKKLGDPNDPLLVSVRSGAPVSMPGMMETILNLGLTDK
SVEGLAKKTSNRRFALDAYRRFIMMYGSTAMGIDRIKFDDLFDEIKEKHTRGRLNIAAGK
KVGDTDVNEDELAEVIIKFKALYKKEIKKDFPQDPIEQLWGAIGAVFNSWMAEKAVTYRR
VENLVGIKGTAVNVMQMVFGNKGDTSGTGVCFTRDPNSGENIFYGDYLFNAQGEDVVAGI
RTPIKLSEFEKEDKKAYDQLCKVRALLENHYKDMQDMEFTVEEGKLYMLQCRTGKRSPAA
AFRMAVDMVNEGLITKEEAIMRIKASDIEGIFYPAIDYKQPNLKSALLVSGIAAVPGAAA
GKICFSAAKAEALAAKKEKAILVRKETSPEDVGGMHAAQGILTATGGKTSHAAVVARGWG
KCCIVGCEKLVIDYEKGECSYNGKVLKEGDFITLDGTKGDVYVGELKLVQAKQPESYKTL
MKWVDETRAIKVRTNADRPEDAKVALEHGAEGIGLCRTEHMFFNDEKRILAIREMIVADS
TEGRKKALAKLLPIQTKDFEGIFKVMDGKGVTIRLIDPPLHEFVPHDKEGQQKLAEALNI
SFASVKERVEQLHEANPMLGHRGCRLAITYPEILEMQVTAIITAACNVHKKGITVLPEIM
IPLTIDPKEFAILEARVRNVADAILKKHDAKIKYAVGTMIETPRAALLADKIAERAEFFS
FGTNDLTQMTLGISRDDAAKFLPAYVDEQKAGVFPADPFQSLDQVGVGLLVKDGIAKGRS
TRPELKVGICGEHGGDLESVKFCCRAGMSYVSASPFRVPIARLAAAQAAIEDKKAGAKKA
AKTAKTAKTAKSAKTATKKK
NT seq 2763 nt   +upstreamnt  +downstreamnt
atggcagaagaaaagtacgtctatttcttcggaaacggcaaggcggaaggcaacggcgaa
atgaagcagctgctgggtggtaaaggcgccggcttggccgaaatgactcgcgcaaagttg
cccgttcccgcaggttttacgattactactgaagtttgtcagttgtattattcgaacaat
aaaaaatatcctgccggtctggagcagtctgtaaaagaaaacttggcaaagctggaaaaa
agtgccggtaagaagctcggtgatcccaatgatccgcttttggtttccgttcgttcaggc
gctccggtttcgatgcccggtatgatggaaacgattttgaacctcggtttaaccgataag
tcggtcgaaggcttagcgaaaaagacgtctaaccgccgtttcgccttggatgcataccgc
cgctttattatgatgtacggctcaacggcaatgggcatcgatcgcataaagttcgatgac
ctttttgatgagataaaagaaaagcatacccgcggacgcttgaacattgcagcgggtaag
aaagtcggcgataccgatgtaaatgaagatgagcttgcagaagttatcataaagtttaag
gcactgtataaaaaagaaattaaaaaagacttcccgcaggatccgatcgaacagctttgg
ggtgctatcggagcggtattcaattcttggatggctgaaaaagccgttacctatcgccgc
gtagaaaatctcgtcgggattaagggtactgcagtcaacgttatgcagatggtattcggt
aacaagggggatacctccggtaccggagtctgctttacgcgcgatcccaatagcggtgaa
aacatattctacggcgattacctctttaatgcgcagggtgaagacgtcgttgcgggtatc
cgtacaccgattaaactctccgagtttgaaaaagaagataaaaaagcctacgatcagctc
tgtaaagtccgcgctcttttggaaaaccactacaaagatatgcaggatatggagttcacc
gtagaagaaggtaaactctatatgctccagtgccgtaccggtaagcgttctcctgccgct
gcgttcagaatggccgttgatatggtaaatgaagggcttatcacaaaagaagaagcgatt
atgcgtattaaggcgagcgatattgaaggtatcttctatcctgccattgactataagcag
cctaatttgaaatccgccttgcttgtcagcggaattgccgcagtcccgggtgcagccgcc
ggaaaaatctgtttttccgctgctaaggcagaggcgctggctgcaaagaaagaaaaagca
attctcgtacgtaaggaaaccagccccgaagatgtcggcggtatgcatgccgcacagggt
attttaactgcgaccggcggaaaaacgagccacgcagctgttgttgcgcgaggttgggga
aaatgctgtatcgtcggatgcgaaaaacttgtcatcgattacgaaaaaggcgaatgcagc
tataacggtaaggttcttaaagaaggcgattttatcacccttgacggaactaaaggcgac
gtatatgtcggcgagctgaaattggtacaggcaaaacagccggaatcatataagaccttg
atgaagtgggttgatgagacacgtgctatcaaagtacgcaccaacgcggatcgtcccgaa
gatgcaaaggtcgcccttgaacacggcgccgaaggtatcggtttgtgccgtaccgagcac
atgttcttcaacgacgaaaaacgtattcttgcgattcgtgagatgattgttgcagacagc
accgaaggacgcaaaaaagccttggctaagctgctcccgattcaaacaaaggactttgaa
ggcatctttaaagtgatggacggaaagggcgttaccatccgcttaatcgacccgccgctg
cacgagttcgtgccgcatgataaagaaggacagcagaaattggccgaagcgctcaatatc
agtttcgcaagcgtaaaggaacgggttgaacagctccatgaagcgaacccgatgctcgga
caccgtggctgccgcttggcaattacctatcccgaaatcctcgaaatgcaggtaaccgct
attattactgcggcatgcaatgtgcataaaaaaggcatcacggtactgccggaaatcatg
atcccgcttaccatcgatccgaaagaatttgcgatccttgaagcgagagtccgcaatgtt
gccgatgcaatccttaaaaaacacgatgctaagattaaatatgcggttggtacgatgatc
gaaactccgcgcgcagcattgttggccgataaaatcgcagaacgggcagagttcttctcg
tttggaaccaacgacttgacgcagatgacgcttggcatcagccgcgacgatgctgcaaaa
ttcttgcctgcctatgtcgatgaacaaaaagcgggagtatttcctgccgatccgttccag
tctttggatcaggttggcgtcggcttactggtgaaagacggtattgcaaaaggccgctct
acccgacccgaattaaaggtcggtatctgcggtgaacacggcggtgatttggaatccgtt
aagttctgctgccgtgccggtatgtcgtatgtttccgcctcgcccttccgtgttccgatt
gcccgtcttgctgctgcacaggctgcaatagaggataaaaaggccggagctaagaaagcg
gctaaaaccgcaaaaacagctaaaacggcaaaatctgctaaaaccgcaacaaaaaagaag
taa

DBGET integrated database retrieval system