KEGG   Treponema sp. OMZ 804: GWP43_05380
Entry
GWP43_05380       CDS       T06435                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00071  Fatty acid degradation
trz00072  Synthesis and degradation of ketone bodies
trz00280  Valine, leucine and isoleucine degradation
trz00310  Lysine degradation
trz00362  Benzoate degradation
trz00380  Tryptophan metabolism
trz00620  Pyruvate metabolism
trz00630  Glyoxylate and dicarboxylate metabolism
trz00640  Propanoate metabolism
trz00650  Butanoate metabolism
trz00900  Terpenoid backbone biosynthesis
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
trz01212  Fatty acid metabolism
trz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GWP43_05380
   00630 Glyoxylate and dicarboxylate metabolism
    GWP43_05380
   00640 Propanoate metabolism
    GWP43_05380
   00650 Butanoate metabolism
    GWP43_05380
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GWP43_05380
   00072 Synthesis and degradation of ketone bodies
    GWP43_05380
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GWP43_05380
   00310 Lysine degradation
    GWP43_05380
   00380 Tryptophan metabolism
    GWP43_05380
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GWP43_05380
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GWP43_05380
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GWP43_05380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:trz04147]
    GWP43_05380
Enzymes [BR:trz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GWP43_05380
Exosome [BR:trz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GWP43_05380
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-ProteinID: QHX42970
UniProt: A0A6P1Y137
LinkDB
Position
complement(1132715..1133923)
AA seq 402 aa
MAVSKSYIISAKRTAIGKFLGGLSTVPPKDMGSTVVKAVLEEAKVKPDQVSELICGNVLG
AGLGQNIARTIALEAGIPETVCAHSVNMVCGSGLRSVMEAVMSIQAGFNDIVLAGGVESM
SLAPYLVPANTRSGNKMGNWQAVDHMIYDALTDARANIHMGITAENIAAKFNITRAQQDE
FAFASQQKAIAAIDAGKFKNEIVPITIHSKKGDTVFDTDEYPNRTTDLEKLAKLKPAFKS
DGTVTAGNASGINDGASFVLVASEAAVKKYNLKPIAEIIGIGQGGVDPLVMGLGPVPAIR
NALNYASLKLSDMELIELNEAFAAQSLGVIHELVREHGVDRDALLKRTNVNGGAIALGHP
VGASGNRILVTLLHEMIKTDKKIGLASLCIGGGQGTAVIVKR
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggctgtatcaaaatcgtacatcatcagtgcaaagcgcactgctatcggtaagtttctc
ggaggcctgtctaccgttccgcctaaggacatgggttcaacggtagtaaaagcggtgctg
gaagaggcaaaggtaaagcccgaccaagtttcggagcttatttgcggtaacgtactcggc
gccggactcggtcaaaatatcgcccgaaccatcgcattggaagccggcattcccgaaacg
gtgtgtgctcactcagtcaacatggtatgcggatccggtttgcgatccgttatggaagca
gtgatgtccatccaagcaggttttaacgacattgttcttgcaggcggcgtagaatcgatg
tcactcgcaccgtatctcgtacccgcaaatacccgcagcggaaataagatgggaaactgg
caggcggtcgatcacatgatttatgacgccttaacggatgcccgtgcaaatatccacatg
ggaattacggctgaaaatatcgccgcaaaatttaatattaccagagcgcagcaggatgaa
tttgcattcgcctcccagcaaaaagcgattgccgctatcgatgcaggtaaatttaaaaac
gaaatcgttccgattactatccattcaaaaaaaggcgatactgttttcgataccgacgaa
tatcccaatcgtaccaccgacctcgaaaaacttgccaagctgaaacctgcttttaaaagc
gacggtactgttacagcaggcaatgcatcgggcataaatgatggggcttcctttgtgctg
gttgcaagtgaagcagccgtaaagaaatataacctcaaacctattgcggaaattatcggc
atcgggcaaggcggtgtcgacccgctcgtaatgggattaggtcccgttccggcaatccgt
aatgcattaaactatgcatcgctgaaactctccgatatggaactgattgaattgaacgaa
gcatttgccgctcagtctttaggcgttatccatgaactggtacgcgagcatggagtcgat
cgcgatgcactgttaaagcgaacgaacgtcaacggcggcgctattgcgctcggccatccg
gttggtgcttcgggtaaccgcattttagtaactcttctccacgaaatgatcaaaacggat
aaaaagatcggacttgcttctttatgcatcggaggggggcaaggaacggccgttattgta
aaacgataa

DBGET integrated database retrieval system