KEGG   Treponema sp. OMZ 804: GWP43_06135
Entry
GWP43_06135       CDS       T06435                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00030  Pentose phosphate pathway
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
trz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GWP43_06135 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    GWP43_06135 (tkt)
Enzymes [BR:trz01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     GWP43_06135 (tkt)
SSDB
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N
Other DBs
NCBI-ProteinID: QHX43094
UniProt: A0A6P1Y0P0
LinkDB
Position
complement(1293964..1295949)
AA seq 661 aa
MNKELDAVALSIRSLSIDAIEKANSGHPGLPLGAAELAAVLYAKILRHNPKNPQWVDRDR
FILSAGHGSMLLYAALHLAGYDLSLDDIRSFRQIGSRCAGHPEYGLTPGVEATTEPLGQG
ISTAVGMAIAEAMLAARFNTEEYRIVDHYTYALVGEGCLMEGVSSEASSLAGTLKLGKLI
VYYDKNNITIDGSTDIAFTEDVTKRYEAYGWQVLHGSMYSYSDIEKLTAEAKKDPRPSLI
ILDSVIGKGAPAVEGTAAAHGAPLGQEKLAQAKKTLGLDPAKQFFVAPEAYRYFEERQKE
FAQAEADWNSRFAAWSAAYPEQRKEWDRSFVQGGIDQAVLDGVTDPVFKKDEMIATRAAS
KTALNAFAKAFPNLVGGSADLQGPNAVALQDAQSFTAATPQGRYIHFGIREFAMATITNG
IQLHGGFRAFCATFAVFSDYLRPALRLAALMRIPSIFVLTHDSIFVGEDGPTHQPVETLA
SLRAIPNLLVLRPADAEETAVAWRIALEQKDRPVCLILSRQNLPILEKAEPQWKALMKAA
GSYIVKDTIGTPDVTILATGSEVSLACEAAELAAPKKVRVVSVPSKELLDAQASSCKAQL
VGNNGRVMVAEAGVKQGWEGWVQSPEKDIFSIERFGESGPAKKVAEHLGFTAQALAARIK
E
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgaataaagaacttgacgccgtagcgctttcgatacggagcctttcaatcgatgcaatc
gaaaaagccaattccggccatcccgggcttccgctcggagccgccgaactcgcagcggtg
ctgtatgcaaaaattttacggcataatccgaaaaatccccaatgggtagaccgcgaccgg
ttcatcttgtcggcggggcacgggtctatgctcctgtatgccgcgctgcatcttgccggt
tacgatctttcgcttgacgatatccgctcattccggcagatcggttcccgctgtgcaggg
catcccgaatacggcctcacccccggcgttgaagccaccaccgagccgctcggtcagggc
atttctaccgcagtcggtatggcgattgccgaagcgatgctggcagcgcggttcaatacc
gaagagtaccgcattgtcgatcactacacctacgcgctggtgggagaaggttgtttaatg
gaaggcgtttcttccgaagcatcgagccttgccggtacgctgaaactcggtaagctcatt
gtatactatgataaaaacaatattacgatagacggttcaaccgatatcgcctttaccgaa
gatgttacaaagcggtacgaggcttacggttggcaggtgctgcacggttcgatgtattct
tacagcgatatagaaaagctcactgcggaggcaaaaaaagatccccgtccctcgctcatc
atactcgattcggtgatcggaaagggagcgcccgccgttgagggaaccgccgccgcacac
ggagcgccgctcggtcaagagaagctggcgcaggcaaagaagacgttggggcttgatcct
gcaaagcagttctttgttgcccccgaagcctaccgttattttgaagagcggcaaaaggag
tttgctcaagcggaagcggactggaatagccgctttgccgcatggagcgccgcctatccc
gaacagcgcaaagaatgggatcgcagctttgtacaaggcggcatcgatcaagccgtactc
gacggtgttaccgatcctgtctttaaaaaagatgaaatgattgcgacgcgggcggcttct
aaaaccgcactgaacgcttttgcaaaggcattcccgaatctcgtcggcggttcggcggac
ttgcaggggccgaatgcggttgccttgcaggatgcccaatcctttaccgcagcaacgccg
cagggacgatacatccacttcggtatcagagaattcgcgatggcaacgattaccaacggt
attcagctgcacggaggtttccgcgccttctgcgcaacctttgccgtgttctccgactat
ctgcgtccggcgctccggctcgcggcgctgatgcgcatcccttctatttttgtattaacc
cacgactccatctttgtcggcgaagacggcccgacccatcaaccggtggaaacactcgca
agcctccgcgccattcctaatctactggtactccgccctgccgatgcggaagaaaccgcc
gtcgcatggagaatcgcgcttgagcagaaagaccggccggtctgtttaatactgagccgc
cagaatctgcccatactggaaaaagccgaacctcagtggaaagctctgatgaaagccgcc
ggcagctatatcgtaaaagacacgatcggtacgcccgatgtaacgatacttgcaaccggt
tccgaggttagcctcgcctgcgaagccgcagaactcgccgctccgaaaaaagtacgggtt
gtttccgttccgtcgaaagagctgctggatgcacaagcatcttcctgtaaagcgcagcta
gtcggtaacaacggccgtgtaatggttgcggaagccggagttaaacaaggctgggaaggc
tgggtacagtcgccggagaaagatattttctcgatagaacgtttcggcgaatcgggaccc
gcaaaaaaagttgcagagcatctcggatttaccgcccaagcgcttgccgcccgtatcaaa
gaatag

DBGET integrated database retrieval system