KEGG   Treponema sp. OMZ 804: GWP43_06220
Entry
GWP43_06220       CDS       T06435                                 

Definition
(GenBank) DUF1957 domain-containing protein
  KO
K16149  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00500  Starch and sucrose metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
Module
trz_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GWP43_06220
Enzymes [BR:trz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GWP43_06220
SSDB
Motif
Pfam: DUF1957 Glyco_hydro_57 Glyco_hydro_38N
Other DBs
NCBI-ProteinID: QHX43105
UniProt: A0A6P1Y0G8
LinkDB
Position
1317365..1318936
AA seq 523 aa
MIKKTLLLIFHAHVPYIRQSDENEPLEAAQLYEMLSYGLLPFLRMCRRLDSDAVSFKCAL
VISPLLCEMLKSSLWQERYGVYLDRHITFAQQELKRTSGTAREDIVRMYLEFLTLNREDF
HTRYKKDILSGINFFVAKGCIELLATSATPCFFPFYQDMPEALTAQIEQGLSSFREDFEA
VPAGFWLPSMGYDTGLDSIIKSYGIDYTVLEGQSFLFADRPPVNGVFSAAIGESGLAFLG
KDSTACADVTNPETGFYLHPDYLDTDKDVGFEFDEQALSPLFDVKKGRRATGFCYHRRGG
GEYNAAAGVLQAEKDAERFIANRNAVLTEAMELLGTDTDPLCSVSVLPLRFLGKTWMEGM
RWLEAVFCKVAQRRDMQCALPTEYLKKVRRIQSINPFYASNLPSGYADELINSSNDWMFP
RIQKATERMIDLAGRFRNDQGLKERMLNMAARELLLAQSTDWPLMADAQISADYAAAECE
EHLAAFTDVYDSLGSGSIGTDRLIKREKEYPIFSDMNYRFFIS
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgattaaaaagacattacttttaatttttcatgctcacgtaccatatatccgccaatcg
gatgagaacgaaccgctcgaagcggcacagttgtatgagatgctgtcatacggtcttttg
ccgttcttacgaatgtgcagacgtttggattccgatgccgtttcgtttaaatgcgcgctg
gtaatttctccgcttttgtgtgaaatgctaaaatcttccttgtggcaagagcggtacggt
gtgtatttggatcggcatataacatttgcacaacaggaattaaagcggacatccggaact
gcccgtgaagatattgtcaggatgtaccttgaatttttaacgcttaatcgagaagatttt
catacccgttataaaaaagatattttgagcggaataaatttctttgttgccaagggatgc
attgaactgcttgcgacatcggcaacaccatgctttttcccgttttatcaggatatgccg
gaagcgcttaccgcacagattgaacaaggcctcagtagttttcgggaggattttgaggcg
gtgcctgcagggttttggcttccgtcaatgggatatgatacgggattagacagcattatc
aagtcttatggtatcgattataccgtattggaaggtcagagtttcttatttgccgatcga
ccgccggtaaatggtgtcttttccgccgccataggcgaaagcggtttggcgttcttaggg
aaagacagtacagcgtgtgctgatgttaccaatcccgaaacagggttttatctgcacccc
gattacctcgataccgataaagacgtcggcttcgaatttgatgaacaagcgctttcacct
ctgttcgatgtgaaaaaagggcggcgtgcaacgggattttgctatcaccggcgaggtggc
ggcgaatataacgcagcggcaggcgtactgcaagcggaaaaggatgccgaacggtttatt
gcaaaccgtaatgcggtattaacggaagctatggaattgctcggtaccgataccgatccg
ctgtgctcggtttccgtattgccgctcaggtttctcggcaaaacgtggatggaaggaatg
cgatggctggaagcagtgttttgcaaagttgcgcagcggcgtgatatgcagtgcgcatta
ccgaccgaataccttaaaaaagtgcggcggatacagagtattaatcctttttatgcttcc
aacctgccgagcgggtatgctgatgaactgattaacagctctaacgattggatgtttcct
cgtattcaaaaggcgaccgaacggatgatcgacctcgcaggacgtttccggaacgatcaa
ggccttaaagagcggatgctgaatatggcagcgagagaactgctacttgcgcagtcgacc
gattggccgctgatggcggatgcccaaatctccgccgactatgccgccgcggagtgtgag
gagcatcttgccgcctttaccgatgtatatgattcgctcggttcgggctcgatcggtacc
gaccggttgattaagagagaaaaagaatatccgatattttcggatatgaattatcgtttt
ttcatatcatag

DBGET integrated database retrieval system