KEGG   Treponema sp. OMZ 804: GWP43_06225
Entry
GWP43_06225       CDS       T06435                                 

Gene name
gpmA
Definition
(GenBank) 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00260  Glycine, serine and threonine metabolism
trz00680  Methane metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
trz01230  Biosynthesis of amino acids
Module
trz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
trz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_06225 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    GWP43_06225 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GWP43_06225 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:trz04131]
    GWP43_06225 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:trz04147]
    GWP43_06225 (gpmA)
Enzymes [BR:trz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     GWP43_06225 (gpmA)
Membrane trafficking [BR:trz04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    GWP43_06225 (gpmA)
Exosome [BR:trz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   GWP43_06225 (gpmA)
  Exosomal proteins of melanoma cells
   GWP43_06225 (gpmA)
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-ProteinID: QHX43106
UniProt: A0A6P1XZU7
LinkDB
Position
1318960..1319703
AA seq 247 aa
MKLVLIRHGESEWNKLNLFTGWTDVELSDKGVEEAKEGGKALAAAGFDFDICYTSYLKRA
IHTLQFVLDELDRNWLPVVKTWKLNERHYGDLQGLNKAETAEKYGEAQVKIWRRSFDIAP
PVLSEDDARCPYLQTAYRGVDKAELPRTESLKDTIARAVPYFESVIKKDMLAGKRVLIAA
HGNSLRALIKYFEHLSDEEIVQVNLPTGVPLVYEFDVNFNVVSKAYLGDQEKINAKINAV
ANQGKAK
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaaattagtgcttatacggcatggcgaaagtgaatggaacaagttgaacctgtttacc
ggttggactgatgtggaattatcggacaagggcgtagaggaagcgaaggaaggcggaaag
gcgcttgccgcagccggttttgactttgatatctgctatacctcatacttaaagcgagca
atccatacgctgcaattcgtattggatgagcttgaccgcaattggctccctgtcgttaaa
acatggaaactgaacgaacggcattacggcgatctgcaaggattgaacaaggctgaaacg
gctgaaaaatacggggaggcgcaggtaaaaatttggcgccgttccttcgatattgcgccg
cctgttctttcggaagacgatgcacgctgcccgtatctccaaaccgcataccgtggtgtc
gataaggcggagttgccccgtaccgaaagcttgaaagataccattgcacgagctgttccg
tattttgaatcggtcattaaaaaggatatgctggcaggtaagcgcgtattgattgccgcg
cacggtaattcgctgcgggcgctcattaaatactttgaacatttgagcgacgaggagatt
gtgcaggtaaatctgccgacgggcgttcccctcgtctatgaatttgatgttaattttaat
gtggtgagcaaggcctatttgggagatcaggaaaaaatcaatgccaagatcaacgccgtt
gcgaaccaaggcaaggcgaagtaa

DBGET integrated database retrieval system