KEGG   Treponema sp. OMZ 804: GWP43_07190
Entry
GWP43_07190       CDS       T06435                                 

Gene name
sdaAA
Definition
(GenBank) L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00260  Glycine, serine and threonine metabolism
trz00270  Cysteine and methionine metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01200  Carbon metabolism
trz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GWP43_07190 (sdaAA)
   00270 Cysteine and methionine metabolism
    GWP43_07190 (sdaAA)
Enzymes [BR:trz01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     GWP43_07190 (sdaAA)
SSDB
Motif
Pfam: SDH_alpha
Other DBs
NCBI-ProteinID: QHX43267
UniProt: A0A6P1Y0J1
LinkDB
Position
1526964..1527902
AA seq 312 aa
MLSYESVNELYKTAEAQHKRIREIVLEDQAAQLELPEEALVKRMEENLTVMLEAIENGSK
PGVKSTSGLTGGDAYRLKQTIAEGKHLCGDLISNAIQMAMAVSEINAAMGKIVATPTAGS
CGILPGALGSLLKTRGVPREEAVLSLFTAGAIGMVVANKASIAGASGGCQAECGTASAMA
AACIVELLGGTPEMAAHAVAIAIKCILGLVCDPVAGLVEIPCIKRNASGVTLAFTAAELA
LAGIKSAIPVDETIESLKRVGDGLPAALRETAQGGLAITPTGQAFERQVFGTRSPLTGNP
CSTCGSCGSCGS
NT seq 939 nt   +upstreamnt  +downstreamnt
atgcttagttatgaatcagttaacgaattatataaaacagcggaagcgcagcataagcgt
atcagggagattgtattagaagatcaagcggcacagcttgaactgccggaagaagcactg
gtcaagcggatggaagaaaacttgacagtcatgctagaggcaattgaaaatggcagtaaa
ccgggagttaaatctacaagtggattaacagggggagatgcatatcggttaaaacagacg
attgcagaaggcaaacatctctgcggagaccttatatcaaacgccatccagatggcgatg
gcagtatctgaaataaatgccgcgatggggaaaattgttgcaaccccaacggccggctcc
tgtggaatcctccccggtgcattgggttctttgctaaaaacgcgcggcgttccgcgggaa
gaagcggtactgtccctatttaccgccggagctatcggtatggtggtagcaaacaaagca
tcaattgccggtgcgtcaggtggctgccaggctgagtgtggcactgcttctgcgatggca
gctgcctgcattgtagaacttttaggcggcacaccggagatggcagcgcatgctgtcgca
atagcaatcaagtgcatcttgggactagtgtgcgaccccgttgccggccttgtagaaatc
ccctgcattaaacggaatgcctccggcgtcacacttgccttcaccgctgcggaactagca
cttgcaggtattaaaagcgcaattcctgttgacgaaaccatcgagtccctcaagcgggtt
ggcgacggacttccggcagcgctacgtgaaactgcccaaggaggtttagcaataacaccg
actggccaggcctttgaacggcaggtatttggtacgcggtcaccacttaccggcaatccg
tgcagtacttgtggctcatgtggatcatgcggcagttaa

DBGET integrated database retrieval system