KEGG   Treponema sp. OMZ 804: GWP43_08305
Entry
GWP43_08305       CDS       T06435                                 

Gene name
glgA
Definition
(GenBank) glycogen synthase GlgA
  KO
K00703  starch synthase [EC:2.4.1.21]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00500  Starch and sucrose metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
Module
trz_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GWP43_08305 (glgA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:trz01003]
    GWP43_08305 (glgA)
Enzymes [BR:trz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.21  starch synthase (glycosyl-transferring)
     GWP43_08305 (glgA)
Glycosyltransferases [BR:trz01003]
 Polysaccharide
  Storage polysaccharide
   GWP43_08305 (glgA)
SSDB
Motif
Pfam: Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_transf_4
Other DBs
NCBI-ProteinID: QHX43445
UniProt: A0A6P1Y1L0
LinkDB
Position
complement(1789284..1790762)
AA seq 492 aa
MRILMITSEAVPFAKTGGLADVVSALSYALKKLGHDVRIVMPRYYRIDKKNLTPIPGAMG
VTIGSREYWTEVFESTLPDSDIPVYFIDHEESFGRDGLYGSAFEPDFNDNPKRFSILSHA
AFQICRKQHWIPDLMHAHDWQTALVPVLLKFNTQYLDFKETASVFTVHNIGYQGIYNKAN
YVDTGLDWVYFYSAGFEDWDRMNFLKAGLLSADRLTTVSPTYAKEIQSAEYGFRMDGILR
FRQEALTGILNGVDTSVWNPKTDEHIPFNYTARSLAKKAKNKEALQKYMGLPQDEKVPVF
GMITRLTDQKGIAELFGPSYGAAFKMCSDINLQLIVLGAGDRWCEDELLALSKRLPNLRV
YVGYDEKLSHLIEAGSDFFLMPSRYEPCGLNQMYSLLYGTLPIVRNTGGLADTVENYDEK
TGKGTGFVLNLLTPESIYNTVNWAVNAWFKHPEHIVKMRKRGMAKDFTWDTSAKQYLAVY
QEAVGNKVFNKH
NT seq 1479 nt   +upstreamnt  +downstreamnt
gtgcgaatattaatgataaccagtgaagcggtgccgtttgcaaaaacaggcggcttagcg
gatgttgtttccgccttatcctacgctttaaaaaaacttgggcatgatgtaagaattgtt
atgccgcgttattatagaattgataaaaaaaatttaacgcctattcccggagcaatgggc
gttactatcggcagtagagagtattggacggaagtttttgaatcgacgcttccggattcc
gatataccggtatattttatcgatcatgaagaaagtttcggccgcgacgggttgtatggt
tccgcatttgaacctgactttaacgacaatcccaagaggttttcaatattgagccatgca
gccttccagatatgcagaaagcaacattggattcccgatctgatgcatgcacatgattgg
cagacggcactcgttcccgtgctgttgaaatttaacactcagtatctcgatttcaaagag
acggcaagtgtttttaccgtacacaatatcggctatcaaggaatttataataaagcaaac
tatgtggatacggggctcgattgggtgtatttttattctgccggttttgaggactgggac
agaatgaattttttaaaagcagggctgctttctgccgatcgtctgacaaccgtttctcct
acttatgcaaaagaaatacagagtgctgaatacggttttcggatggatggtattctccgg
ttccgtcaggaagcattgaccggtattttaaacggtgtggatacctctgtgtggaatccc
aaaacggatgagcatattccctttaattataccgcccgttctcttgcaaaaaaggcaaag
aataaagaagccttgcaaaaatatatgggacttcctcaagatgaaaaggttccggtattc
ggtatgataacacgattgaccgatcaaaagggaattgcggaattgttcggcccgtcttac
ggagctgcatttaagatgtgcagcgatatcaatttacagctgattgtacttggtgccgga
gaccgatggtgcgaagatgaattgttggcgctttcaaaacggctgccgaacctccgtgtg
tatgtcggttacgatgaaaaattgagccatttaatagaagcgggaagcgacttctttttg
atgccgtcgcgatatgaaccgtgcggacttaatcagatgtactcactgctatatggaaca
ttgcctattgtacgcaataccggcggacttgcagacacggtagaaaactatgacgaaaaa
acaggaaagggcaccggttttgtactgaatctgcttacgcctgaaagtatttataatacc
gttaattgggcggtaaatgcgtggtttaagcatcccgaacacatcgttaaaatgcgcaag
cgcggtatggcaaaggattttacatgggatacctctgcgaagcagtatcttgccgtgtat
caagaggctgtcggaaataaggtgttcaataagcattaa

DBGET integrated database retrieval system