KEGG   Treponema sp. OMZ 804: GWP43_08320
Entry
GWP43_08320       CDS       T06435                                 

Definition
(GenBank) AMP-binding protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00061  Fatty acid biosynthesis
trz00071  Fatty acid degradation
trz01100  Metabolic pathways
trz01212  Fatty acid metabolism
trz02024  Quorum sensing
Module
trz_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GWP43_08320
   00071 Fatty acid degradation
    GWP43_08320
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GWP43_08320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:trz01004]
    GWP43_08320
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:trz04147]
    GWP43_08320
Enzymes [BR:trz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     GWP43_08320
Lipid biosynthesis proteins [BR:trz01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   GWP43_08320
Exosome [BR:trz04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   GWP43_08320
  Exosomal proteins of breast cancer cells
   GWP43_08320
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-ProteinID: QHX43448
UniProt: A0A6P1Y0Y0
LinkDB
Position
1792299..1794041
AA seq 580 aa
MNKMSKRPWEFLDAWRGKKFTGEWPTLPEMFEITAERFPNRNCLTVFEPDRITLTYRETL
TAIKKLAGWFVAHGVKRGTHIAVSGKNSSEWAIVYLSALYAGGIIIPIDYGLHDYEIESL
LKTAKPLFFFVDEEKYDHFFEAAKSQTFIGEVYSLNSNLADRYVYNLEAEPLAACFPLRE
TDTAAILFTSGTMGNPKGVMLSHRNIVSDCYIAQSHLTIFETDVFYALLPIHHSYTMVAV
FIEAISVGAEIVFGKSLVVSRMLRELKEGKITMLLGVPLLFNKLLAGIMKGVRSKGVLVY
GIIRFLMGVSYLVKKTTGKNIGKKLFKSVLEKANLTTLRIAISGGEPLSKEVFRAYNEFG
IDFVQGYGLTETSPIIALNPKEHFKIESVGSYFHPYMEMKILDPDENGRGEICARGPMIM
QGYYNMPEETAQVLSADGWFRTGDIGWLDDEKYLYLCGRAKNLIVTSGGKNVYPEEIENA
FQMYYNDIEQITVMGYHPADDLTSEEIEVLVYPADELYKTLNLDRGTPAGDSAVYKRIEA
IVEIVNKELLPYQRITKTTLLDKPLEMTTTKKVKRYNGHL
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgaacaaaatgtcaaaaaggccatgggaattccttgatgcatggcgcgggaaaaagttt
accggagaatggccgacattaccggagatgtttgaaattactgccgagcgttttccgaat
agaaactgtttaaccgtctttgaaccggatcggatcactctcacctatcgtgaaacgctt
acagcaattaaaaaattagcgggctggtttgtcgctcatggtgtaaaaagaggaacgcat
atcgccgtctccggcaaaaattcttccgaatgggcaatcgtctatttaagtgcgctgtat
gccggcggtattattatcccgattgactacggtttacatgattatgaaattgaatcgctt
ttaaaaacggcaaaaccgctttttttctttgtcgatgaagaaaaatatgatcattttttt
gaagcagcaaaatctcagacattcataggcgaagtgtattctttaaacagcaatcttgcc
gatcgctatgtatataatttggaagcagaaccgctcgcagcctgttttccactacgcgaa
acggatacggcagcaattctgtttacctccggtacaatgggtaatcccaaaggtgttatg
ctatctcaccggaatatcgtctcagactgttacattgcccaatcgcacttaacgatattt
gaaaccgatgttttttatgcactattgccaatccaccactcctatactatggttgccgtc
tttatcgaagcgatctccgtcggcgcagaaatcgtattcggaaaatccttagtagtatcc
cgtatgctgcgtgaattgaaagaagggaaaattaccatgctcctcggcgtaccgctgctc
tttaacaagctgctcgccggtattatgaaaggagtgcgcagcaaaggcgtattagtatac
ggcatcatccggtttctgatgggtgtttcgtatcttgttaaaaagacaacagggaaaaat
atcggtaaaaagctctttaaaagcgtattggaaaaggcaaatctcacaacgcttaggatc
gcgatttcaggcggggagccgctttcaaaagaagtgttcagagcatacaatgagttcggt
atcgattttgtgcaagggtacggactgactgaaacatcgccgattatcgcgttgaatccg
aaagaacactttaagattgaaagcgtcggcagttatttccacccctacatggaaatgaaa
atccttgatcctgatgaaaacggccgtggggaaatctgtgcaagaggtccgatgatcatg
cagggctattacaatatgccggaagaaaccgcacaagtgctatcggcagacgggtggttc
cgcaccggtgatataggctggcttgacgatgaaaaatatctgtatctctgtggacgcgca
aagaacctcatcgttacctccggcggcaagaatgtataccccgaagaaatagaaaatgcc
ttccagatgtattacaacgatatcgagcaaatcaccgtaatgggataccaccctgcagac
gatttgacaagcgaggaaattgaagtattggtatatcccgccgatgagctgtataaaaca
ttgaatcttgacaggggaacccctgcaggcgacagtgctgtttataaaagaatagaagcg
attgtcgaaatcgtgaacaaggaactgctaccctatcagcggataacaaaaaccacgctt
ttggataaaccgctcgaaatgaccacaaccaagaaggttaaacggtataacgggcatctc
taa

KEGG   Treponema sp. OMZ 804: GWP43_09840
Entry
GWP43_09840       CDS       T06435                                 

Definition
(GenBank) AMP-binding protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00061  Fatty acid biosynthesis
trz00071  Fatty acid degradation
trz01100  Metabolic pathways
trz01212  Fatty acid metabolism
trz02024  Quorum sensing
Module
trz_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GWP43_09840
   00071 Fatty acid degradation
    GWP43_09840
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GWP43_09840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:trz01004]
    GWP43_09840
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:trz04147]
    GWP43_09840
Enzymes [BR:trz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     GWP43_09840
Lipid biosynthesis proteins [BR:trz01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   GWP43_09840
Exosome [BR:trz04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   GWP43_09840
  Exosomal proteins of breast cancer cells
   GWP43_09840
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-ProteinID: QHX43686
UniProt: A0A6P1Y1F6
LinkDB
Position
2099572..2100996
AA seq 474 aa
MELLRYAEEDPQRVLAITDSGKTLHYSEINTAAAALPKEAAHQLVFLLCRNSPGTLLGYL
GCLKAGVVPLLLDAHIAPDLLQHLIQTYTPAFYYIPQDLPEETKKILPMNKPVTTIADSV
LLRSDKKGPELFQDLALLLTTSGSTGSPKLVRLTYRNIYENARSIAEYLHITDKERPVTM
LPMSYSYGMSIINSHALMGATVILTGHDILTAAFWERVKQENVSSLVGIPYTYQMFSRLR
LTEMELPALKTLTQAGGKLPYELHQKFGEWSLNTGRRFFVMYGQTEAAPRMAYLPPDKTM
EKCGSMGIAIPGGELKLIDEAGAEITASDTVGELVYHGQNVSMGYAECATDLAKGDEWQG
TLHTGDMAKRDSDGYFFIVGRKKRFIKVFGNRVNLDDTERLLSAAFADAEFACIGQDDLL
CVYTTLKTEEQHRAVSEYLAQTTRLPAKVFHVFFIEAIPKNPAGKTLYSQLEIR
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggaattgttgagatatgctgaagaagatccgcagcgggtattggcgataaccgatagc
ggtaaaacattacattacagcgaaatcaatacagctgcagcagcactcccgaaagaagca
gcccatcagctggtgttccttctctgtagaaattcgcccgggacgctgctcggatacctc
ggttgcttaaaggcaggcgtcgtaccgcttttgttggatgcacacatcgcacccgatctt
ttacaacacttaattcaaacctatacgcccgccttttattatattccgcaagacttaccg
gaagaaacaaaaaagatactcccgatgaataaacccgttacaacaatagcggacagtgta
ctactccgttcggataaaaaagggccggagctttttcaagatttagcgctgctcctcacc
acatcaggaagtaccggcagccccaaactcgtacgcttaacgtaccgcaatatctacgaa
aacgcacggtcaatcgcagaatacctgcacattaccgacaaggagcgtccggtaactatg
ctgccgatgagctattcatacggaatgtccattatcaatagccatgcccttatgggcgca
accgtcatattgacagggcacgatatcttaaccgctgcgttctgggaacgggttaagcaa
gagaacgtcagttcgcttgtgggcatcccctatacctatcaaatgttctcccgcctacgg
ttgaccgaaatggagctgcccgcactcaaaacgctgacgcaagcggggggaaaattgccg
tatgagctacatcaaaaattcggcgaatggagcctgaacaccggacggcgcttttttgtg
atgtatgggcaaaccgaagccgcaccgcgcatggcatatctgccgccagataagacaatg
gaaaaatgcggcagtatgggcattgcaatccccggcggagaattaaaactaattgacgaa
gccggtgcggaaattaccgcgtccgatactgtcggtgaattggtgtaccacggacaaaat
gtttcgatgggatatgcggaatgcgctaccgatttagcgaaaggcgacgagtggcaggga
acgctccataccggggatatggcaaaacgggattcggacggttatttttttatcgtcggg
aggaaaaagcggtttatcaaagtgttcggcaatcgggttaatttggatgataccgaacgg
ctgctgtctgccgcctttgccgatgccgaattcgcttgtatcggacaagacgaccttctc
tgcgtttatacaacgcttaaaacggaagaacagcatcgcgcagtatcggagtatctcgca
caaacgacacggcttccggcaaaggtgttccatgtcttttttatcgaggctatccctaag
aatcccgcgggtaaaacgctctattcgcagctggagatacgctag

KEGG   Treponema sp. OMZ 804: GWP43_10060
Entry
GWP43_10060       CDS       T06435                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00061  Fatty acid biosynthesis
trz00071  Fatty acid degradation
trz01100  Metabolic pathways
trz01212  Fatty acid metabolism
trz02024  Quorum sensing
Module
trz_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GWP43_10060
   00071 Fatty acid degradation
    GWP43_10060
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GWP43_10060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:trz01004]
    GWP43_10060
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:trz04147]
    GWP43_10060
Enzymes [BR:trz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     GWP43_10060
Lipid biosynthesis proteins [BR:trz01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   GWP43_10060
Exosome [BR:trz04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   GWP43_10060
  Exosomal proteins of breast cancer cells
   GWP43_10060
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-ProteinID: QHX43725
UniProt: A0A6P1Y2B8
LinkDB
Position
2147793..2149715
AA seq 640 aa
MNDITMPQLLQQITKKYPNIAAQYSKNEQGDFNPLSYTDVFDRVLSFAGGLLSLGITRGD
RVGLIADNRKEWYHASMGIMTIGAADVPRGCDATEQDLIRILSFAECTAAVIENRDQFIK
ILKNQQQFPLLKTLIVFDPFDIHDEELKTKGNTSRFTMYSYDEIIERGMGYRKAHPEAVE
QELEKGSDTEVATIIFTSGTTGEPKGVMLTHKNFIVQLDDLKTRVILYPGEKAIVVLPVW
HSFERLCEYVILASAAGMVYSKPVGSILLADIAKTNPALFPSVPRIWESVYTGVFKAMKQ
AGGIKQKLFNFFVAVGLFHAHHARNVKGLNPHFVFYTKITRPIISFIPYLFSLPLYALGN
VLVFKKIRTKLGTGFRQGVSGGGALPPNIDAFFWAIGVSVTEGYGLTETAPVVSVRPLGR
PVFGTIGKPLSCTTVKIVDDNGKELPVGQLGTVMIRGTSVMKGYYKRQDLTDAVIDKDGW
FDSGDLGLKTLDGELILRGRKKDTIVLRGGENTEPVPIEMKLQESPFIAQAVVLGQDQRF
LGALIVADETEVKSYAAEQGILADSFEDLLAKPEIKKLFERQIASLINHENGFKLFERIN
RFVLLAKPFEAGVELSAKQDVMRYKITSLYSNQIDSLFAD
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgaacgacatcacaatgccgcaattgttgcaacaaattacaaaaaaatatccgaatatt
gccgctcaatattccaagaatgagcaaggcgattttaatccgctctcctacactgatgtt
tttgatcgggtattgagttttgcaggcggactgttatccctcggcatcacgcggggagac
agagtcggccttatcgcagataacaggaaagagtggtaccatgccagcatggggattatg
acgatcggagcagccgatgttccgcgcggctgtgatgcaaccgaacaggatttgatacgt
attttgtcctttgccgaatgtacggctgctgtcatagaaaatcgggatcaatttataaaa
attctgaaaaatcagcagcagtttccgctgctcaaaacgctcattgtgtttgatcctttc
gatattcacgatgaagagctcaaaacaaagggcaacacttcccgctttacaatgtacagc
tatgatgagattatcgaacggggtatgggatatcgaaaagcacaccccgaagcggttgaa
caggagctggaaaaaggcagcgatacggaagttgctacgatcatttttacctccggtacg
acaggcgaacctaagggcgttatgctgacgcataaaaactttattgtgcagctggatgac
cttaaaacgagggttatcctctatcccggcgaaaaggccattgtggtactgccggtatgg
catagctttgagcgactctgcgaatacgttatcttagcttccgccgcggggatggtgtac
tccaaaccggtgggaagcatcttgcttgcagatatcgcaaaaaccaatccggcgctgttc
ccatcggtgccgcgtatctgggagtccgtctataccggtgtttttaaggcaatgaagcag
gcaggcggtattaagcaaaaactgttcaacttctttgtcgcggtaggcttgttccatgca
caccatgcacggaatgttaaagggcttaatcctcattttgttttttatacgaagatcacc
cgtcctattatttcctttataccgtatcttttctccctgccgctctacgcgctgggtaac
gtgctcgtgtttaaaaagatccgtaccaaactcggcaccggcttccggcaaggggtttca
ggcggaggggcactaccgccgaatatcgacgcgttcttctgggctatcggtgtaagcgtt
accgagggctacggtttaaccgaaacggcaccggttgtgtcggttcgcccactcgggcgc
cccgtattcggtactatcgggaagccgctgtcatgtacgacggtaaagattgtcgatgac
aacgggaaagagctgccggtaggtcaactcggtaccgtaatgatccgcggcaccagcgtt
atgaaggggtattacaagcggcaggatttaaccgatgcggtcatcgacaaggacggttgg
ttcgacagcggcgacctcggattaaaaacgcttgacggcgaacttatcctacgtggcaga
aaaaaagatacgatcgtactacgcggcggagaaaataccgagccggtaccgattgaaatg
aagctgcaggaatcaccattcatcgcgcaagccgtagttctcgggcaggatcagcgcttt
ttaggcgcactcattgtcgcagacgaaaccgaggttaaaagctatgcggcagagcaaggg
atattggcagactcatttgaagacctgctggcaaaaccggaaatcaagaaactttttgag
cgacagatcgcttcgctgataaaccatgaaaacggctttaaactgtttgaacgaatcaat
cgttttgtactccttgccaaaccttttgaagcaggcgtagaactctcggcaaagcaggat
gtaatgcgctataagatcacgtcgttatatagtaatcaaattgatagtttattcgctgat
taa

KEGG   Treponema sp. OMZ 804: GWP43_11380
Entry
GWP43_11380       CDS       T06435                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00061  Fatty acid biosynthesis
trz00071  Fatty acid degradation
trz01100  Metabolic pathways
trz01212  Fatty acid metabolism
trz02024  Quorum sensing
Module
trz_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GWP43_11380
   00071 Fatty acid degradation
    GWP43_11380
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GWP43_11380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:trz01004]
    GWP43_11380
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:trz04147]
    GWP43_11380
Enzymes [BR:trz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     GWP43_11380
Lipid biosynthesis proteins [BR:trz01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   GWP43_11380
Exosome [BR:trz04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   GWP43_11380
  Exosomal proteins of breast cancer cells
   GWP43_11380
SSDB
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Other DBs
NCBI-ProteinID: QHX43945
UniProt: A0A6P1Y340
LinkDB
Position
complement(2436501..2438228)
AA seq 575 aa
MQTINELKHYTFQAMLENSIKRFGERPALSFVSGEPISYNEAGEQIKQLQQRLYCLGVNP
GDKIAIYSHSVPHWGIAYFAIVTMGAIAVPLLPDFTDKEVKACLEHSETTMIIVSEKLMS
RVPDTVSVLIDIQDFSVKKGTEIRDGNPPPHTCKEDDTASVIYTSGTTGRSKGVELSHKN
LVCNAIAGQSCQRINEYDRALSILPLSHVYEFTIGFLMFFLNGACVYYLEGIPSPRILLP
ALTKVRPTMMLSVPIVMEKIYKNKILPALTSSPFRAWLYHTKLGKKLLNRLAGKQLKKTF
GGHLKFFGLGGSKTDTTVEEFLRDAKFPYVIGYGLTETAPLIAGSTVRQSVPGWIGYAIP
DVEVKIDNPDPKTGIGELLVKGLNVMKGYYRAPELTKNSFTEDGWFKTGDLFMMDKRGHL
AIKGRSKNMILGASGENIYPEDIEFVLNQHPLVTESLVVEGEKSSLVAYVQLDEEKIAAE
VQKEQNQNKEGSAIQNLQSAVAGAVSGLTDAMAYKRAEILNEIKFFVNSSVNKMSRIDKI
EPVEGFEKTASQKIKRYLYNFANRGKKEGEVPAGK
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgcaaacaatcaatgaactaaaacattatacctttcaagcgatgctggaaaatagcatc
aagcgatttggggaacgcccagcactttcatttgtgtcgggagaaccgatttcgtacaat
gaagccggtgagcagataaagcagctgcagcaacgtctgtactgtctcggtgttaacccc
ggcgataagattgcaatctacagtcatagcgttcctcattgggggatcgcctattttgcg
attgttacgatgggtgccattgccgtgccgctgctgcccgattttaccgacaaagaggtc
aaggcctgtttggagcattccgagacgacgatgatcatcgtttcggaaaaactgatgagc
cgagtacccgacaccgtttccgttctcatcgatattcaggacttttcagttaaaaagggt
acggaaataagagacggcaaccctccgcctcatacctgcaaagaagacgataccgcttcc
gttatttatacgtccggtacgacggggcgttccaagggtgtggaactttcgcataaaaac
ctcgtttgcaatgcaatcgcaggacagtcctgccagcgtattaacgagtatgaccgggcg
ctttccattctgccgctttctcatgtatatgaatttacgatcggctttttgatgttcttt
ttgaatggcgcctgcgtgtattacctcgaaggaatcccatcgccgcggatactccttcct
gctttgacgaaggtacgcccgacgatgatgctaagcgttcccatcgttatggaaaaaata
tacaaaaataagatacttcctgcgcttacttcctcgccgttccgtgcatggctgtatcat
actaagctcggcaagaaactccttaaccgccttgccggaaagcagctgaaaaaaacgttc
ggcggacacctgaaatttttcggattgggcggctcgaaaaccgatacgaccgttgaggaa
ttcttgagagatgctaaattcccgtatgttatcgggtatggtttaacggaaacggcgccg
cttattgccggttctaccgtccgccaaagcgttccgggctggattggttacgctatcccc
gatgtcgaagtgaaaatcgataaccctgaccccaaaaccggtatcggggaactgttggtc
aaaggactaaatgtgatgaaaggctactatcgcgcccctgaactcacaaaaaattcgttt
accgaagacggctggttcaaaaccggcgatctttttatgatggataaaagagggcattta
gcgattaaaggccggtcaaagaacatgatcctcggcgccagcggtgagaacatttacccc
gaagatattgaatttgtgctgaatcagcatccgctcgtaacggaatcgctcgtggttgaa
ggagaaaagtcttctcttgtcgcctacgtacagcttgatgaagaaaaaatcgcagccgag
gtgcaaaaagaacagaatcaaaacaaagaaggctctgccattcaaaatctgcaatccgcc
gtagcaggcgctgtttccggcttgacggatgcgatggcttataaacgagcggaaatttta
aacgagattaaatttttcgttaattccagtgtgaataagatgtcgcggatcgataagatc
gaaccggtcgaagggtttgagaagactgccagtcaaaaaattaagcgatatctctataat
tttgcaaatcgagggaaaaaagaaggcgaggttccggcagggaaataa

DBGET integrated database retrieval system