KEGG   Treponema sp. OMZ 804: GWP43_09645
Entry
GWP43_09645       CDS       T06435                                 

Gene name
rpe
Definition
(GenBank) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00030  Pentose phosphate pathway
trz00040  Pentose and glucuronate interconversions
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
trz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GWP43_09645 (rpe)
   00040 Pentose and glucuronate interconversions
    GWP43_09645 (rpe)
Enzymes [BR:trz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     GWP43_09645 (rpe)
SSDB
Motif
Pfam: Ribul_P_3_epim QRPTase_C
Other DBs
NCBI-ProteinID: QHX43655
UniProt: A0A6P1Y251
LinkDB
Position
complement(2057592..2058221)
AA seq 209 aa
MGASFILAPSLLSADFSRLAEELHFIEANGGQWVHLDVMDGVFVPNLTFGAPVVRSLRSK
STLPFDVHLMVSRPQDFVKDFSAVGADYFTFHIEAAVHAHRLITEIRAAGMKPGVSIVPS
TPVHLLDEVLPFVDLVLVMTVNPGFGGQTMIPRCLEKIKTLYEYREKYDYRYLISADGGV
NAETLPAVCNAGADVIVSGSSFFSGEIKK
NT seq 630 nt   +upstreamnt  +downstreamnt
atgggggcatcgtttatattagcgccgtctttattgagtgcagacttttcacggctcgcc
gaagaattacattttattgaagcaaacggaggtcaatgggtgcatcttgatgtgatggac
ggagtctttgtaccgaatttaacgttcggtgctcccgttgtgcgtagtctacggagtaag
agcacccttccttttgatgtgcatttgatggtttcccgccctcaagattttgtaaaagat
ttttcagcggtaggagcagattatttcacgtttcatattgaagcggcagtgcatgctcat
aggcttattacggaaattcgtgcagcaggtatgaaacccggcgtgagtatcgtgccgtcg
acccctgtacatcttttagatgaggtgttaccttttgtcgatcttgtgttggtgatgacg
gttaatccgggcttcggtggacaaacgatgattccccgctgcctcgaaaagatcaaaacg
ttgtatgagtaccgtgaaaagtacgattaccgctatttaatttccgctgacggcggcgtt
aatgcggaaacgcttccggctgtatgcaatgccggtgccgatgttatcgtgtcaggatca
tcttttttttccggagagataaagaaatga

DBGET integrated database retrieval system