KEGG   Treponema sp. OMZ 804: GWP43_09765
Entry
GWP43_09765       CDS       T06435                                 

Definition
(GenBank) phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00051  Fructose and mannose metabolism
trz00562  Inositol phosphate metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
trz01230  Biosynthesis of amino acids
Module
trz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
trz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_09765
   00051 Fructose and mannose metabolism
    GWP43_09765
   00562 Inositol phosphate metabolism
    GWP43_09765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:trz04147]
    GWP43_09765
Enzymes [BR:trz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     GWP43_09765
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GWP43_09765
Exosome [BR:trz04147]
 Exosomal proteins
  Proteins found in most exosomes
   GWP43_09765
  Exosomal proteins of colorectal cancer cells
   GWP43_09765
  Exosomal proteins of bladder cancer cells
   GWP43_09765
  Exosomal proteins of melanoma cells
   GWP43_09765
SSDB
Motif
Pfam: PGK
Other DBs
NCBI-ProteinID: QHX43674
UniProt: A0A6P1Y2G3
LinkDB
Position
2083440..2084696
AA seq 418 aa
MVKTVRDVDLHGKRVIMRVDFNVPMKDGVVQDDTRIVAALPTIKYILEQKPRSLVLMSHL
GDPAKDSKKAEEKAAKDGKPFDKEAYIAGKHKMKPVAAYLEKLLGMPVRLADSCKGQKAV
VDALPEGGILMLENTRFHPEETSKDTAEQETLAKELASYGDVYVNDAFGTAHRAHASTAT
IAKFMKVKVAGFLMEKEVKYIEPMVKNPPKPMVAIIGGAKVSSKIAVLDSLLKNAAALII
GGGMAYTFLKAQGHSIGKSLVEDDFIDTAKKLLTDAEAKGVKIILPVDHICAASFAADAK
PESVDGCDIPDSLMGMDVGHKTIELYKAEILNAKSIVWNGPVGVFEFEAFSHGTEAVARL
VAEATGKGAVTVVGGGDSVAAVNKFHLADKMSHVSTGGGASLEFLEGKTLPGIACLDA
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggttaaaacggtaagagatgtagatcttcacggcaagcgtgttatcatgcgggttgat
tttaatgttccgatgaaggacggggttgtgcaggacgatacgcgaatcgttgcagcatta
ccgactatcaaatatattttagagcaaaagccgcgttcgttggtgttgatgagccacctc
ggcgatcctgccaaagattcaaagaaagctgaggaaaaagcggctaaggacggcaagccg
tttgacaaagaggcctacatcgccggtaagcataagatgaagccggtagcggcatatttg
gaaaaactgttaggtatgcccgttcggcttgccgattcctgcaaaggacaaaaggcggta
gtcgatgcacttcccgaaggcggtatcttgatgcttgagaatacgcgcttccatcccgaa
gaaacctcgaaggacactgcagaacaggaaacacttgccaaagagcttgcctcctacggc
gatgtatacgtcaacgacgcattcggaactgcacaccgtgctcatgcttctacggcaacc
atcgcaaaatttatgaaggtaaaagttgccggttttttaatggagaaagaagttaaatat
attgaaccgatggtaaaaaatccgcccaaaccgatggtcgccatcatcggcggcgcaaaa
gtttcttcaaaaattgccgtactggatagtcttttgaaaaatgccgctgcgctgattatc
ggcggcggtatggcgtataccttccttaaagcgcaaggccattcaatcgggaaatccttg
gtggaagatgattttatcgacacggcaaagaaacttttaaccgatgccgaggcaaagggc
gttaaaataatcctgccggtagaccatatttgcgccgcctcttttgccgccgatgcaaaa
ccggaaagcgtggacggctgcgacatccccgattcgcttatgggaatggatgtcgggcat
aaaaccatcgaattgtacaaggcagagattttgaacgcaaagtccatcgtatggaacggc
ccggtcggcgtgtttgaatttgaagctttctcccacggaacggaagcggttgcccgcctt
gtggccgaagcaaccggaaaaggcgcagtaacggtagtcggcggcggcgactccgttgca
gccgtcaacaagttccatcttgccgataaaatgagccacgtatctaccggcggcggcgcc
tcactcgaatttttggaaggaaaaacgctgccgggcatcgcctgcctcgatgcataa

DBGET integrated database retrieval system