KEGG   Treponema sp. OMZ 804: GWP43_10340
Entry
GWP43_10340       CDS       T06435                                 

Definition
(GenBank) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00051  Fructose and mannose metabolism
trz00052  Galactose metabolism
trz00500  Starch and sucrose metabolism
trz00520  Amino sugar and nucleotide sugar metabolism
trz00521  Streptomycin biosynthesis
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
Module
trz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_10340
   00051 Fructose and mannose metabolism
    GWP43_10340
   00052 Galactose metabolism
    GWP43_10340
   00500 Starch and sucrose metabolism
    GWP43_10340
   00520 Amino sugar and nucleotide sugar metabolism
    GWP43_10340
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GWP43_10340
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GWP43_10340
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:trz04131]
    GWP43_10340
Enzymes [BR:trz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     GWP43_10340
Membrane trafficking [BR:trz04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    GWP43_10340
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1
Other DBs
NCBI-ProteinID: QHX43773
UniProt: A0A6P1Y3U7
LinkDB
Position
complement(2205933..2207273)
AA seq 446 aa
MDIRHSVAAFFGRHNFDAEGPTVNTVIDTLLYDMEEGLKRDPSIPVGTGPALDMIPTWFM
PPQQPPKNTSVIVIDAGGTNFRSCLVTFDENSVPSISQLERKPMPATDREYSKAEFFDTI
ASYLDHLKNAADSIAFCFSYAMKITPAGDGEVLQFSKEIKAPEVIGSLVGQNLEAALMQR
GWNKLKRIVLLNDTVAALLAGASTAVGGKKYDSYVGFILGTGMNAAYIEYQNIPKIASNS
AGTVALPAQIVVCESGKSNKQPRSDFDEAFAKKTDQPQMFWFEKMCSGAYLGSVASVMIR
AAAADNLFSAGVKKAFASIADLPLIDVNRFLQAPYSDQTPLGQLLTGGTEEDREVLYRIL
DALIMRTARLAAGNIAAAVIKTGKGKNPALPVCILAEGTTFLKTYRLHDAVIAHLYRALT
QKRGIYFDVVSLEHAITFGTAIAGTI
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggacattcggcattcggttgctgcgtttttcgggcggcataattttgatgcggaaggc
cccacggtcaatacggttatcgatacgctgctgtatgatatggaagaagggctgaaacgg
gatccgagcattcccgtcggtacggggccggctctggatatgattcctacgtggtttatg
ccgcctcagcagccgcccaaaaatacttcggttatcgttatcgatgcaggcggaaccaat
ttccggtcatgcttggttacctttgacgaaaacagcgtcccgtccatcagtcagcttgag
cggaagccgatgccggcaaccgatcgggaatactccaaagcggaattttttgataccatc
gcctcttatttagaccatttgaaaaacgccgcggattctatcgcattttgcttttcgtat
gcgatgaaaattactccggcaggcgacggcgaagtgctgcaattttctaaggaaatcaaa
gcgcccgaggtaatcggctcattggtcggccaaaatttggaggcggcgctgatgcagcgg
ggctggaataagctgaaacgcattgtactgttaaacgatacggttgcggcgctcctcgca
ggggcatcaactgctgtcggcgggaaaaaatacgattcgtatgtaggctttatcctcgga
accggaatgaacgccgcgtatatcgaatatcagaacattccgaaaattgcgtcgaacagt
gctggtaccgtagccttgcctgcgcagattgtcgtctgcgagtcgggaaagtcgaacaaa
cagccgcgcagcgattttgatgaagcgttcgcaaaaaagaccgaccagccgcagatgttt
tggtttgaaaaaatgtgctcaggcgcctacctcggatcggttgcttcggtgatgatacga
gcagccgctgcggacaatcttttttccgccggcgttaaaaaagcgtttgcttccattgcc
gaccttccgctcatcgatgtaaaccgctttttgcaagcgccgtattccgatcaaacccca
ctcggacagctgttaaccggcggcacggaggaagaccgcgaggttctctaccggatattg
gatgcgctgattatgcgcacggcacggctcgctgcggggaatatcgcggcggctgtcatt
aaaacaggcaagggaaaaaatcctgcgctgccggtttgtatccttgcggagggtacaacg
tttttaaaaacgtaccggttgcatgatgctgtcatcgcgcacctctatcgggcgctgaca
caaaaacgcggcatttattttgatgtggtgtccctcgagcatgcaattacgttcggcacc
gctatcgcgggcacgatttaa

DBGET integrated database retrieval system