KEGG   Treponema sp. OMZ 804: GWP43_10890
Entry
GWP43_10890       CDS       T06435                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00053  Ascorbate and aldarate metabolism
trz00071  Fatty acid degradation
trz00280  Valine, leucine and isoleucine degradation
trz00310  Lysine degradation
trz00330  Arginine and proline metabolism
trz00340  Histidine metabolism
trz00380  Tryptophan metabolism
trz00410  beta-Alanine metabolism
trz00561  Glycerolipid metabolism
trz00620  Pyruvate metabolism
trz00625  Chloroalkane and chloroalkene degradation
trz00770  Pantothenate and CoA biosynthesis
trz00903  Limonene and pinene degradation
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_10890
   00053 Ascorbate and aldarate metabolism
    GWP43_10890
   00620 Pyruvate metabolism
    GWP43_10890
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GWP43_10890
   00561 Glycerolipid metabolism
    GWP43_10890
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GWP43_10890
   00310 Lysine degradation
    GWP43_10890
   00330 Arginine and proline metabolism
    GWP43_10890
   00340 Histidine metabolism
    GWP43_10890
   00380 Tryptophan metabolism
    GWP43_10890
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GWP43_10890
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    GWP43_10890
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GWP43_10890
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GWP43_10890
Enzymes [BR:trz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     GWP43_10890
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-ProteinID: QHX43870
UniProt: A0A6P1Y3J9
LinkDB
Position
2325041..2326417
AA seq 458 aa
MTRIAIAALVRNTSTFFASNATKSYQFRAEQLRKLGAAVHAYEQRISDALYKDLHKAPME
TYLTEIGMVQEEIRFLSKHLKKLMKPKRVRTPLSHFLASSTIYYEPYGTVLIMSPWNYPV
NLTLTPLAGAIAAGNCAVIKPSNYTPETSKVIADLITETFDPSFVTVVTGGREENAGLLE
QKFDYIFFTGGTVVGKLVMEAAARNLTPVTLELGGKSPCIIDKTADMKAAARRILFGKIL
NGGQTCVAPDYVLIHTAVKEAFIEQCKAVLREFLPTDAYASCNMTRIVNDKHFERLSHLM
EGEAAVIGGDKDVHGRFIPLTILDNISFESPVMQEEIFGPILPLIPFSDVQWAVDQIRAR
PKPLALYLFTKDAAVEQKILSEVSFGGGCINDTIVHLATPYMPFGGVGTSGMGNYHGKQS
FYTFSHEKSVMKKSLLVDLPMRYHPYSEKNFNLVKKFM
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgacaagaatagccatcgccgcattggtgcggaatacttcaactttttttgcatcaaat
gcgacaaaatcatatcaattccgcgcagaacagctccgtaagttgggagccgccgttcac
gcgtatgagcaacggataagcgatgcactctataaggatttacacaaggcgccgatggag
acctaccttacggaaatcggtatggtgcaggaggaaatccgctttctatcgaaacattta
aaaaaattgatgaagccgaaacgggtgcgcacgccgctcagtcattttttagcgtcgagt
acgatttattatgaaccgtacggcaccgtgttgattatgtcgccgtggaactatcccgtc
aatttaacgctgactccgcttgccggtgcgattgctgcaggaaactgcgcggtgataaag
ccgtcgaattacacccccgaaacctcaaaagtaatcgccgatttgattacggaaaccttt
gatccgagctttgttacggttgtaaccggcggacgagaagagaatgccgggcttttggag
caaaagttcgattacatcttctttaccggcggtacggtagtcggtaagcttgttatggaa
gcagctgcgcggaacctgacgccggtaacgctggaactcggcggcaagtccccctgtatt
atcgataaaaccgccgatatgaaagcggcggcgcgacgtatccttttcggtaagatactg
aacggcgggcaaacctgcgtcgctcccgactatgtgttaattcacactgcggtaaaagaa
gcgtttatcgaacagtgtaaggcagttctccgtgaatttttaccgacggacgcgtatgcc
tcatgcaatatgacgcggattgtcaacgacaaacattttgaacggctttctcatttaatg
gaaggagaagcggctgttatcggcggagacaaggatgtgcacgggcgttttattccgctg
acgatactggacaatatcagctttgaatcgccggttatgcaggaagaaattttcggtcct
atcttaccgctcatcccgtttagcgatgtgcagtgggctgtcgatcaaatccgtgcccgc
ccgaagccgcttgccctctatctctttaccaaggatgccgccgtagagcagaagatcctg
tcggaagtatcgttcggcggcggatgcatcaacgacacaatcgtgcatcttgcgacaccg
tacatgcccttcggcggcgtcggaacaagcggcatggggaattaccacggaaaacaaagc
ttttacacattcagccacgaaaagagcgtaatgaaaaaatccctgctggtagacttaccg
atgcgctatcatccctacagcgagaaaaatttcaacctcgttaaaaagtttatgtag

DBGET integrated database retrieval system