KEGG   Treponema sp. OMZ 804: GWP43_10995
Entry
GWP43_10995       CDS       T06435                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00020  Citrate cycle (TCA cycle)
trz00620  Pyruvate metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
Module
trz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_10995
   00020 Citrate cycle (TCA cycle)
    GWP43_10995
   00620 Pyruvate metabolism
    GWP43_10995
Enzymes [BR:trz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GWP43_10995
SSDB
Motif
Pfam: 2-oxoacid_dh
Other DBs
NCBI-ProteinID: QHX43886
UniProt: A0A6P1Y1Y5
LinkDB
Position
2344703..2345632
AA seq 309 aa
MKDKKTELELKKVAMPIPAKRRFGDRKEGRRIRSVEPMTVVAPFIMPSRIGSQNLFQDSI
NVAAIEHFVHKKRAEGLTGFGIMHVVIAAYVRTISQRPGINRFLSGLRLYARHNIEVVMA
VKKEMTLEAEETMMKFFFDRSATVTDVYNEMTHKIDEYRNTRKEKESAFDKIARKLGFMP
NFQLRAAIAFLNWLDFHNLLPERLRLLSPFHCSVVFSSMGSLGIRPIFHHLYNFGNAPVF
ITFSAMRRSQEITRDGTVTNIRNLDLTVTTDERICDGFYYASAFHELHKYLEEPELLEQP
PEKIIYDIE
NT seq 930 nt   +upstreamnt  +downstreamnt
atgaaagacaaaaaaactgaattggaacttaaaaaagtagctatgcccattccagccaaa
cgacgattcggcgatagaaaagaaggaagacgtatccgttcggtagagcctatgacggta
gtggctccctttattatgccatcaagaataggatcacaaaatttatttcaagacagcatc
aatgtagcggcaattgaacatttcgtgcataaaaagagggcagaaggccttaccggtttc
ggtattatgcatgtagtgatcgctgcctatgtacgaactatatctcaacggccgggaatt
aaccgatttttaagtggattacggctttatgctcgccataatatagaagttgttatggct
gtcaagaaagagatgacgctggaagccgaagaaacaatgatgaagtttttctttgaccga
agtgcaaccgttactgatgtatataacgagatgacccataaaatagatgaatatcgaaat
acgcggaaagaaaaagagagtgcttttgataaaatcgcacgtaaacttggatttatgccg
aattttcaattacgtgcagcgatcgcgtttctgaactggctcgatttccacaacttgtta
ccggaaagattgagactgctcagtccttttcactgttctgttgtattctcttctatggga
tcattaggtatccgtcctatatttcaccatttgtacaatttcggtaatgcccccgtattt
attacttttagtgcaatgcggagatcacaagaaattacgcgagatggcacggttactaac
atacggaacctcgaccttactgttacaaccgatgagcgcatctgcgacggattttactat
gcatccgctttccatgaattgcataaatatttagaggaacctgaattgcttgaacagccg
cccgaaaagattatctacgatatagaataa

DBGET integrated database retrieval system