KEGG   Treponema sp. OMZ 804: GWP43_11055
Entry
GWP43_11055       CDS       T06435                                 

Gene name
gap
Definition
(GenBank) type I glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
trz01230  Biosynthesis of amino acids
Module
trz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
trz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_11055 (gap)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:trz04131]
    GWP43_11055 (gap)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:trz04147]
    GWP43_11055 (gap)
Enzymes [BR:trz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     GWP43_11055 (gap)
Membrane trafficking [BR:trz04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    GWP43_11055 (gap)
Exosome [BR:trz04147]
 Exosomal proteins
  Proteins found in most exosomes
   GWP43_11055 (gap)
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N VirE3
Other DBs
NCBI-ProteinID: QHX43895
UniProt: A0A6P1Y2Z1
LinkDB
Position
complement(2359200..2360249)
AA seq 349 aa
MKVAINGFGRIGRLVFQALVEQNLLGKDKFDVVAVVDLSTDAKYFAYQLKYDSVQGKMNA
EIGTKGDDVLVINGHEIKCVSGKGLTPAQLPWKELGIDLVIESTGLYTNEKAYGHLEAGA
KKVIISAPGKSADAAKPIKTIVMGVNENEYDPAKHHVVSNASCTTNCLAPLVHVILKEGF
GIETGLMTTIHSYTATQKTVDGVSLKDWRGGRAAAINIIPSTTGAAKAVGEVLPSTKGKL
TGMSFRVPTPTGSVVDLTFRATKDTSIEELDAAFKKASETYMKGILGYCNEDIVSTDIIH
DKRSSIYDSKATLQNNLPGEKRFFKVVSWYDNEWGYSNRVIDLLKFMNK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaagtagctattaacggattcggcagaatcggtcggcttgtgttccaggcattggtt
gaacagaatttgcttggaaaggataaatttgatgtcgttgcggttgtcgatctttcaacc
gatgcaaagtattttgcctatcagcttaaatatgattccgtacagggcaagatgaatgcc
gaaatcggtacaaaaggcgatgatgtactggtgattaacgggcatgaaatcaaatgcgtc
tccggcaagggcttaacccctgctcagcttccgtggaaggaattaggcatcgatctcgtt
atcgaaagcaccggcttgtacacaaacgaaaaagcctacggccatttggaagcaggtgca
aagaaggttattatttccgcgcctggtaaaagcgctgacgccgcaaagcccattaaaacc
atcgttatgggtgtaaacgaaaatgaatatgatcctgcaaaacatcacgttgtttccaat
gcaagctgcaccaccaactgtttggcacctcttgtccatgtcattttaaaagaaggtttc
ggaattgaaacgggattgatgacaacgatccactcttataccgcaacacagaaaaccgtt
gacggtgtttctctgaaagactggcgcggcggacgggcagctgctatcaatattatcccg
tctacgaccggcgctgctaaagctgtcggcgaagtattaccttcaacaaagggcaagctg
accggtatgtcattccgcgtaccgactcccaccggttcggttgtcgatttaaccttccgt
gcaacaaaagatacctctattgaagagttggatgcagcattcaagaaagcctccgaaacc
tatatgaaggggattttaggctattgcaacgaagacatcgtttccaccgatattattcac
gacaaacgatcttccatctatgacagcaaggcaacgctccagaataacctcccgggcgaa
aagcgcttctttaaagtagtgtcatggtatgataacgagtggggatattccaaccgcgtt
atcgacctgctcaaatttatgaataaataa

DBGET integrated database retrieval system