KEGG   Treponema sp. OMZ 804: GWP43_11455
Entry
GWP43_11455       CDS       T06435                                 

Gene name
nifJ
Definition
(GenBank) pyruvate:ferredoxin (flavodoxin) oxidoreductase
  KO
K03737  pyruvate-ferredoxin/flavodoxin oxidoreductase [EC:1.2.7.1 1.2.7.-]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00020  Citrate cycle (TCA cycle)
trz00620  Pyruvate metabolism
trz00650  Butanoate metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
trz01200  Carbon metabolism
Module
trz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_11455 (nifJ)
   00020 Citrate cycle (TCA cycle)
    GWP43_11455 (nifJ)
   00620 Pyruvate metabolism
    GWP43_11455 (nifJ)
   00650 Butanoate metabolism
    GWP43_11455 (nifJ)
Enzymes [BR:trz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     GWP43_11455 (nifJ)
    1.2.7.-  
     GWP43_11455 (nifJ)
SSDB
Motif
Pfam: POR_N POR EKR PFOR_II Fer4_16 TPP_enzyme_C Fer4_7 Fer4 Fer4_10 Fer4_6 Fer4_9 Fer4_2 Fer4_21 Fer4_8 Fer4_17 Fer4_4 EspB Fer4_13
Other DBs
NCBI-ProteinID: QHX43958
UniProt: A0A6P1Y2A4
LinkDB
Position
2459358..2462912
AA seq 1184 aa
MPEKNLVMIDGNTAAGHVAHALSEVIAIYPITPSSPMGEVADEYSAHGKTNIWGTVPQVV
ELQSEGGASGAVHGALTTGALSSTFTASQGLLLMIPNMYKIAGELTSTVFHVAARALATS
ALSIFGDHQDVMACRQTGWAMLASNSVQEVMDLAIIAHTATLEARVPFLHFFDGFRTSHE
IQKIEEVSQDVMRQMVNDDLVRAHRLRGLTPEKPMIRGTAQNPDVYFQAREAVNKYYLAT
PEIVQRVMDKYATLTGRAYHLFDYYGDPNAESVIILMGSGADTVEETVDYLNSQGKKYGL
LKVRLYRPFSAEAFVKALPASVQNITVLDRSKEPGSLGEALYEDVRTAIGEMQAAKKCPF
THYPVILGGRYGMGSKEFTPAMVKAVFDNMEGEKKSNFAVGIEDDVTHVSLAYDHHFHVD
DSGMHQAMFYGLGSDGTVGANKNSIKIIGEATDNNAQAYFVYDSKKSGSITTSHLRFGKK
KIRKPYLVGQADFIACHKFTFLETYDMLKSLKKGGTFLLNSHWNKDEVWEHLPIEVQKDL
IAKEAKFYVIDGVKIAEKAGMGNRINVVMQTAFFKIFGILPEDEAVALIKKFIEKSYGKK
GSEIVQKNIKTIDMALEGVEQVTYPKEATSKLSRHAAMSADAPEFVRKILGKIAINEGDA
VKVSEIPADGTFPTATTQYEKRAIAEHIPIWKSELCIQCGQCTIVCPHAAIRMKVYDKSN
IGHAPSAFRSIPYKGKEFDNSLFTIQVSPEDCTGCGICVEQCPAKSKENPAIRAINMEGF
VEHRAVESENWKFFMSLPDPDTRKVNLSQPKGIGMRRPLFEFSGACAGCGETPYIGVLSR
LFGDRAVIANATGCSSIYGGNLPTTPYAKRADGRGPVWSNSLFEDAAEFGYGMRLTSDKL
AEYAREVAGKLKAKGVAVAAIDKVLSNTQADDAAIDEQRGFVADLKKELEKSSDPLAKEL
LSLTDHFVKRSVWILGGDGWAYDIGYGGLDHVLASGRNINVLVLDTEVYSNTGGQMSKAT
QIGAIAKFAASGKETSKKDLGMMAMSYGYVYVAQVSMGANMSQVIKAFREAESYDGPSII
IAYSHCINHGINMTKGMSNQKEAVTCGLWPLYRYDPRLTDQGKNPFQLDSKEPDFNLADF
MYKEVRFKSLKNANPERAQMLLDKAVAKAKRRWQEYKYLADRPF
NT seq 3555 nt   +upstreamnt  +downstreamnt
atgcctgaaaaaaacctcgtaatgattgacggtaatactgccgccggtcatgtcgcgcat
gcactcagcgaagttatcgcaatttatcctatcacgccgtcaagcccgatgggggaagtt
gccgatgagtattccgcccacggaaaaaccaatatctggggaaccgtgccgcaagtcgtc
gaactgcaatccgaaggaggagcctccggagccgttcacggtgcattaaccacgggagcg
ctctcttcaacctttaccgcatcacagggtctcttactgatgatccccaatatgtacaaa
attgccggtgagcttaccagcacggtattccacgttgcagcccgtgctctggcaaccagc
gcactctccatcttcggcgaccatcaggacgttatggcatgccgccaaaccggttgggca
atgctggcttccaactccgtacaggaagttatggatctcgcgattatcgctcatactgcg
acgcttgaagcgcgcgttccgttcctccacttcttcgacggttttagaacctctcacgaa
attcagaagattgaagaagtttcgcaggatgtgatgcgccagatggtcaatgacgatctg
gtacgcgcacaccgtctccgcggcttaacgccggaaaaaccgatgattcgcggaaccgct
cagaaccccgacgtatacttccaagcgcgcgaagcggttaataaatactatctggcaacc
cccgaaatcgttcagcgggttatggataaatacgcgaccttaaccggacgcgcttatcac
ttgttcgactattatggcgatcccaatgcggaatcggtcatcattctgatgggttcaggt
gctgacacggtagaagaaaccgtagactatctgaatagccaaggtaaaaagtacggctta
ctgaaagtacgcttataccgccccttcagcgcggaagcttttgtaaaagcattacccgct
tccgtacagaatatcaccgtactcgaccgatcgaaagaacccggctcgctcggcgaagcc
ctctacgaagatgtgcgcactgcaatcggtgaaatgcaggctgcaaagaaatgccccttt
actcactatcccgttatcctcggcggtcgctacggtatgggttcaaaagaattcactccg
gcaatggttaaagccgtattcgataatatggaaggagaaaagaagagcaactttgccgtc
ggtatcgaagacgacgtaacgcatgtaagccttgcctacgatcatcacttccatgttgac
gattccggtatgcatcaggcgatgttctacgggctcggctcggacggtacggtcggcgct
aacaagaactccatcaaaattatcggtgaagcgaccgacaacaacgcgcaagcctatttt
gtgtacgactccaagaagtccggatcaattaccacatcgcacctgcgcttcggcaagaaa
aagatccgcaagccctacctcgtcggacaagcagactttattgcgtgtcataaattcacc
ttcctcgaaacctacgatatgctcaagagtcttaaaaaaggcggtactttccttttaaac
agccactggaataaggatgaagtatgggagcatctgccgatagaagtgcagaaagacctt
atcgcgaaagaagcgaagttctacgttatcgacggtgtcaagattgcggaaaaagcgggt
atgggcaaccgtatcaacgtcgttatgcagaccgcattctttaagattttcggtattttg
cccgaggacgaagcggtagcgctgattaagaaatttatcgaaaaatcctacggcaagaaa
ggatcggaaatcgttcagaagaacatcaagaccatcgatatggcgcttgaaggggttgaa
caggttacctatcccaaagaggcaacgagtaaactttctcgccatgccgcaatgagcgcc
gatgcgccggagtttgtccgcaaaatattaggcaaaatcgctatcaatgaaggtgatgcg
gtaaaggtgagcgaaattccggcagacggtaccttcccgactgcaacgactcagtatgaa
aaacgtgcaattgcagagcatataccgatttggaagagcgaactctgtattcagtgcggt
cagtgcaccattgtgtgtcctcatgctgctatcagaatgaaggtctacgataaatccaat
atcggccatgcgccttccgcattccgctctataccgtataagggcaaggaattcgataat
tccctctttaccattcaggtttctcccgaagattgtacgggatgtggtatctgcgtggag
cagtgtcctgcaaagtctaaggaaaatccggcgattagagcgattaatatggaaggcttt
gtcgagcaccgtgctgttgaatcggaaaattggaagttctttatgagccttcccgacccc
gatacgcgcaaggtcaacttgagccagccgaaaggtatcggtatgcgccgcccactcttc
gagttctccggcgcttgcgcaggttgcggtgaaactccctatatcggtgttctgtcgcga
ctcttcggtgatcgtgccgttattgcaaacgcaaccgggtgttcttccatttacggcggt
aatctccccacaactccgtatgcaaaacgtgcggacgggcgaggaccggtatggtcaaac
tccctctttgaagatgccgccgaattcggttacggtatgcgcttaaccagcgataagctt
gcggaatacgcgcgcgaagttgccggtaagctcaaggcaaaaggtgttgccgttgccgct
attgataaggtattgagtaatacgcaggccgatgatgcggcaatcgatgagcagcgcggc
tttgttgccgatctgaaaaaggaattggaaaaatcttccgacccgcttgcaaaagagctg
ttgtccttgaccgatcactttgttaagcgttccgtatggatactcggcggtgatggttgg
gcatacgatatcggatacggcggtttggatcacgtgcttgcttccggcagaaacatcaac
gtactggtactcgatacggaggtgtattccaacaccggcggtcagatgtcaaaggctacc
cagatcggcgctattgcaaaattcgccgcatccggtaaggagaccagcaaaaaagacctc
ggtatgatggcgatgagctacggctatgtgtatgttgcacaggtttccatgggtgcaaat
atgtcgcaggttatcaaagcattccgtgaagcggaaagctatgacgggccttcgatcatc
atcgcatatagccattgtatcaaccacggtatcaacatgacgaagggtatgtcgaaccag
aaagaggccgttacctgcggtctgtggccgttgtaccgctacgatccgcgcttaacagat
caaggtaagaaccccttccagcttgacagcaaagagccggactttaaccttgcagacttt
atgtacaaagaagtacgcttcaagtcgttaaagaatgcaaatcccgaacgcgctcaaatg
ctgcttgataaagcggttgcgaaggcaaagcggcgctggcaggagtataagtatctggcc
gaccgcccgttctaa

DBGET integrated database retrieval system