KEGG   Treponema sp. OMZ 804: GWP43_11705
Entry
GWP43_11705       CDS       T06435                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00010  Glycolysis / Gluconeogenesis
trz00052  Galactose metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
trz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWP43_11705
   00052 Galactose metabolism
    GWP43_11705
Enzymes [BR:trz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     GWP43_11705
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-ProteinID: QHX44000
UniProt: A0A6P1Y3Y3
LinkDB
Position
2508423..2509478
AA seq 351 aa
MEVKKERFGMLSSGDAVSIFTVSNGTMSFSAIDYGCCITAILLPAAKGGYDDIVLGYSTL
EGYIRNKPYFGSIVGRCAGRISNARFSIEEKCYTLTRNDGGRHCLHGGYPLYGKQLWQAE
PISGSDEAGIRFSRISPNGEQGFPGEVQLTVSYTLNKNNTITLRYEAHTTKTTPISLTNH
TYFNLNPAGMQDDGSYVSVLNHQVQLLASRYAEVDALLIPTGTLVPVAGTPFDFRTPKLL
SQDFAQLKNGYDDTWLLDADGADDVPLAAVVTEPTTGRTLRIYSTQPAITMYTGNFLNGE
QGKNGDVYNKHSGVCFETQHIPDSPNHPAFPSVWVQPGEAYRHETQWRFTV
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggaagtaaagaaagagcggttcgggatgctgtcatcgggagatgcggtatcgattttt
acggtttctaatggcacaatgtcgttttcggcaatcgattacggctgctgtattaccgcg
attttattacccgcagcaaagggcggatatgacgatatcgtgctcggctattcaacgctc
gaagggtatatccgtaataagccttatttcggttctattgtcgggcgatgtgcaggtcgt
atttcaaatgcccgcttttctatagaagaaaaatgctatacactgacccgcaatgacggc
ggaagacattgtttgcatggcggttatcctctgtatggcaagcagttgtggcaagcggaa
cctatttccggcagtgatgaggcgggtatccgtttttccagaataagtcctaacggagag
caaggctttcccggcgaagttcagcttaccgtttcgtataccctcaacaaaaacaatact
atcacgcttcggtacgaggcacatacaacaaaaacaaccccaatcagtctaacaaatcat
acgtattttaatctgaaccctgcggggatgcaggatgatggaagttatgtttcggtgttg
aatcatcaagttcagcttttggcaagtcgctatgcagaggtcgacgctttgcttataccg
accggcacgctggtgcccgtagcagggacgccgttcgatttccgtacgccgaagttgtta
tcacaggattttgctcaattgaaaaacggctatgacgatacatggctgcttgatgcggat
ggtgcggacgatgttccgcttgctgcggttgtaacggagccgacgacaggcagaacgctg
cgtatttattcaacacagccggcaattacgatgtataccggaaactttttaaacggagag
cagggtaaaaacggcgatgtgtataacaagcattccggcgtgtgctttgaaactcagcat
ataccggattcgcccaatcatccagcgttcccttccgtatgggttcagcccggcgaagcg
tatcggcacgaaacgcagtggcgctttacggtttag

DBGET integrated database retrieval system