KEGG   Treponema sp. OMZ 804: GWP43_13105
Entry
GWP43_13105       CDS       T06435                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
trz  Treponema sp. OMZ 804
Pathway
trz00500  Starch and sucrose metabolism
trz01100  Metabolic pathways
trz01110  Biosynthesis of secondary metabolites
Module
trz_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:trz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GWP43_13105
Enzymes [BR:trz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     GWP43_13105
SSDB
Motif
Pfam: Glyco_hydro_77
Other DBs
NCBI-ProteinID: QHX44234
UniProt: A0A6P1Y3X4
LinkDB
Position
complement(2744723..2746783)
AA seq 686 aa
MKCSPLNQALCGAAVPVSALYSQKSCGVGEFSDLIPFADFCKKVGLRIIQLLPVNDTGTD
SSPYNALSAFALHPLYICLDDIPEAHSFKAEIKKICTAFRPHTPAEHFRYRDILHEKNVL
LHAVFNKAESQIIADSQTGELAEWIKANPWIIEYAVFKNIKRQNYHASWKDWKECADMRS
PSTAKITAAWNDSVLKREHLFYAWVQMHLHKQLLKAIAYCADNGISVKGDIPILMNEDSV
EVWAHPEYFRGDLRAGSPPDGDNPTGQNWGFPIYNWVNLKVTGYRWWKERLAHASQYYHA
YRLDHILGFFRIWAIPEGETTGLLGKPIPYAEITMKDLRKAGFSQERIRWMAEPHINTDI
VQTAVNGDYLYAHGLLYKVADRVGTEELWLFKDEIQSEVDIRRCGLPPEVETALRQKWTD
RMLVKAGKDLRGTVVYTAAYLYRNTTAWGTLSEDEQRRFSLLVEEKETEQNKLWAVQAED
ILSELCASVDMQPCAEDLGSKPAALPEILGKLHILSLRVFRWEREWKKDGAPFIPLCDYP
QEAVAVTSVHDSSTLREWWEEELSYADMLSFFNALRIDGNIRRALCPIDGKKPTYTADLA
AALLSALVKVPSVFAIFPIQDWLGLMIDEIHTVKPQDERINIPGTVSDSNWTYRLSFPIE
TLSKDKELIKRLRSITALRNPPKKNL
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgaaatgttcaccgcttaatcaggctttatgcggggctgccgtaccggtttccgctttg
tacagtcaaaaaagttgcggcgtcggcgaattttccgacctcattccttttgcagacttt
tgcaaaaaagtaggactgcgcattattcaacttttacccgtcaatgatacaggcaccgac
agttccccatataatgctctttcggcttttgcattgcatccgctctacatctgcttggat
gatataccggaagcacatagcttcaaggctgagattaaaaaaatatgcactgcctttaga
ccgcacactccggcggagcattttcggtaccgggatatacttcacgaaaaaaatgtactg
ctgcatgctgtatttaataaggctgaatcacagattattgcggattctcagaccggtgag
cttgcggaatggataaaggcaaatccgtggataatcgaatatgcagtgtttaaaaatatc
aagaggcaaaactatcacgcttcgtggaaggactggaaagaatgtgccgatatgcgttct
ccttcaacggcgaaaatcactgctgcatggaacgattctgtcttgaaacgagaacatctg
ttctatgcgtgggtacaaatgcatctgcataaacaattgttaaaagccattgcctattgt
gccgataacgggatttcggtaaaaggcgatattccgattttgatgaacgaagattccgta
gaggtgtgggcacatcccgaatatttccgcggtgatctccgtgcgggcagtcctcctgat
ggggataatcctacgggacaaaattgggggttccccatttataactgggtaaatttgaaa
gtaaccggctaccgttggtggaaggaacggctcgcccatgcatcgcagtattatcatgcg
taccggcttgatcatatcttaggtttttttagaatttgggctattcccgaaggggaaaca
acagggcttttgggaaaacccatcccttatgcggaaattacaatgaaagatttaagaaaa
gcaggtttttcccaagaacgtattcgatggatggcagagccgcatatcaataccgatatc
gttcaaactgcggtgaacggcgactatttgtatgcgcatgggttattgtataaagttgcc
gatagagtcggtacggaagagctctggctttttaaagatgaaatacaaagcgaagtggat
atacgtcgttgcgggctgccgccggaagtagaaacagctttgcggcaaaaatggactgac
cgtatgcttgtaaaagccggaaaagacttacggggaacagttgtgtatactgcggcatat
ctataccggaatacaaccgcatggggaacgctatcggaggacgaacaaagacgattttca
ttgttggtcgaagagaaagaaacagagcaaaacaaactgtgggcagtgcaggcagaagat
attttgtcggaattatgtgcttccgtcgatatgcagccatgcgccgaagatttgggctcg
aaacctgcggcattgccggaaattctgggaaaattacatattttgagcctgcgggtattc
cgctgggaacgtgaatggaaaaaggacggtgctccttttattccgctgtgcgactatcct
caagaagcggttgcggtaacttccgtgcatgattcttcgacactgcgggaatggtgggag
gaagaattgtcttatgcagatatgctttcgttctttaatgctctgcgtattgatggtaat
atacggagagccctgtgtcctatcgacgggaaaaagccgacctatacggcggacttagct
gcagccttattgagcgctttagtcaaagttccgtcggttttcgctatctttcccatacaa
gattggttgggactcatgattgatgaaatacatacggtcaagccgcaggatgagcggatt
aacatccccggtacggtcagtgattcgaactggacataccgactgtcgtttccgatagaa
actttaagcaaggataaagaattgataaaacgattgcggagtataacggcattacggaat
ccgccgaagaaaaacctctaa

DBGET integrated database retrieval system