KEGG   Terriglobus saanensis: AciPR4_0508Help
Entry
AciPR4_0508       CDS       T01408                                 

Definition
(GenBank) Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00500  Starch and sucrose metabolism
tsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AciPR4_0508
Enzymes [BR:tsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AciPR4_0508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ADV81343
UniProt: E8V368
LinkDB All DBs
Position
618498..620921
Genome map
AA seq 807 aa AA seqDB search
MNALTTAYRWLNDDGPAFGAPGLEPRWTSSKKDAVCTAYAASSRVWFTVSHGTLNEIYYP
TIDRPQTRDMELIFTDGETFVHEEKRDYEFDFHYIDPDALAVRVVANDLQGRYTITKEFI
TDPHHPVVLVHVKVEGEEEVLSRLKCYALLAPHLDGGGAGNSARSVEVAGQRAILAWKNG
TALAMGVSTGFTRTSCGYVGSSDGYQDLIQNMRMDWEFGQALDGNLALTGEIDISRNREF
TLAIAMGEGFHSALAGMMQSLSTPYELQLKRFIEQWHRAASPERLAEASTDGGRLMRISH
NTILAHEDKTYSGAFIASASIPWGNAKGDDDLGGYHLVWTRDMIQSATAMLACGRVDTAR
RALVYLACTQRPDGSFAQNFWIDGTPYWTGIQLDEVAFPIMLAWRLWKVDGLGEFDVFPF
VENAAAFLVHFAPVTQQERWEETSGYSPSTLATVIAALVCAADIARAHHSPELAEFLLIY
SDWIEAHLDEWTTTNDGCLHPDVKRHYMRVRPPSPGEPFYHPEAGEGRLNIANRAPGEKY
NFEAREIIDGGFLELVRYGIRRADDPLIIDSLKVVDHVLKIDTPYGPCWRRYNHDGYGQQ
KDGEPFIHYGQGRAWPILTGERAHYEMAAGNDIKPLITALERFSSFGGMLPEQIWDYADL
PEEGLYFGRSAGSAQPLVWAHAEYIKLLRSAVDGKVFDRISVVEDRYCKKAEDRTFKSEV
EFFQVSRPVARLSSQKRLQVLDKNRFQVMWTSDGWKTKNTTDARLLGYPGFSAEIPAQAA
GSQIEFTLFWPLEARWLGKNYFVAVTS
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctcttacgacggcataccggtggctgaacgacgacggtcccgcctttggtgct
cccggcctcgaaccacggtggacttccagtaaaaaagacgccgtctgtacggcgtatgca
gcctccagccgcgtttggtttacggtctcgcatggcacgttgaatgagatctactatccc
accattgatcgtccgcagacccgcgatatggagctcatctttaccgacggagagaccttc
gtccacgaagaaaagcgcgactacgagttcgacttccactacatcgatcccgacgccctc
gccgtgcgcgtcgtcgccaacgatctgcagggtcgttacacgattaccaaggaattcatc
accgatccgcatcatcccgtcgtcctggttcacgtcaaggtcgagggcgaagaagaagtc
ctctcgcgcctgaagtgttatgcccttctcgcaccgcatctcgatggaggcggtgcaggg
aactcggcccgctccgtggaagtcgccgggcagagagccattctcgcctggaagaacggc
acggcgctggccatgggcgtcagtaccggtttcacaagaacttcatgcggttacgtcggt
tcttccgatggttaccaggatctaatccagaacatgcgcatggactgggagttcggccag
gcgctcgacggcaatcttgctctgacgggcgaaatcgacatcagccgcaaccgagaattc
acactcgccatcgccatgggagaaggctttcattcggcccttgctgggatgatgcaatcc
ctctccacaccctatgagcttcagctcaagcgtttcatcgagcagtggcaccgcgcggct
tcgccggagcgtctggcggaggcttcgactgatggtggacgcctgatgcgcattagccac
aacacgatcctggcgcatgaagacaaaacctactccggagccttcatcgcgtccgcctcc
atcccctggggcaacgcgaagggcgacgacgatctcggtggataccatctcgtctggacg
cgcgacatgatccagtccgccacggcaatgcttgcctgcgggcgcgtggacacagcacgc
agggcgctcgtctatctcgcctgtacgcagcggccagacggcagttttgcgcagaatttt
tggatcgacggaacaccctactggaccggcattcagctcgacgaagtggccttccccatc
atgctggcctggcgcctctggaaggtcgatgggttaggcgaattcgatgtctttcctttt
gtggaaaatgcggcagcgttccttgtgcactttgcaccggtaacgcagcaggagcgatgg
gaagagacctccggttactctccctcgaccctcgccacggtgattgcagcgctggtttgt
gccgcagatatcgcccgcgcgcaccactctccggaactggctgagttcttgttgatttac
tcggactggatcgaagcccatctggacgaatggacgaccacgaacgatggatgcctccat
cccgacgtgaaacggcactatatgcgcgtccgtccgccgtcgccgggcgagccgttctat
caccccgaagcgggcgaaggtcgcctgaatatcgccaatcgcgctccgggagagaagtac
aactttgaagcccgcgagatcatcgacggcggctttctggaacttgtccgttacggtatc
cgccgcgccgacgatcccctcatcatcgacagcctgaaggtggtcgatcacgttctgaag
atcgataccccctacggcccctgctggcgtcgttacaaccatgacggctatggacagcag
aaggacggcgaacctttcatccattacggacagggacgcgcatggccgattttgacaggg
gagcgcgcccactacgagatggcggcgggaaatgacatcaagcccctgatcaccgccctc
gagcgcttttcttcctttggcggcatgctgccggagcagatctgggattatgctgatctc
cccgaggagggcctgtatttcggccgttctgccggatcggcgcagccccttgtctgggcg
catgcggaatacatcaagctccttcggtcggcggtcgacggcaaggtcttcgaccgcatc
tcggtggtggaagatcgttactgcaagaaagccgaagaccgtaccttcaagagtgaagtc
gagtttttccaggtttcacgcccggtagcgcggctttcgagccagaaacggctgcaggtt
ttagataagaatcggtttcaggtcatgtggacatcagatggctggaagacgaagaacacc
accgatgcacggctgctggggtatccgggtttctccgcggagattccagcccaggcagcg
ggatcgcagatagaattcacgcttttctggcctttggaagctcgctggttaggcaaaaat
tactttgtggcggtaacctcgtga

DBGET integrated database retrieval system