KEGG   Terriglobus saanensis: AciPR4_3907Help
Entry
AciPR4_3907       CDS       T01408                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00564  Glycerophospholipid metabolism
tsa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AciPR4_3907
Enzymes [BR:tsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AciPR4_3907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 HI0933_like NAD_binding_8 GIDA Pyr_redox FAD_binding_3 Pyr_redox_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ADV84656
UniProt: E8V2V9
LinkDB All DBs
Position
4693672..4695258
Genome map
AA seq 528 aa AA seqDB search
MKREEMLQRIKARGEKPWDIVVIGGGATGVGVAVDAAVRGYDVLLLEREDFGKGTSSRST
KLVHGGVRYLEQGNVSLVMEALKERGLLRQNAPHLVHDLPFVVPNYSWWEAPFYGIGMKI
YDLLAAKYSFGKSKILSREETMERLPNIETAGLRGGVVYHDGQFDDTRLLTHLAMTAADH
GATLLNYAAVTSLTLGEDGFIQGVIVEERESGETISIAAKSVVNATGIFTDEVRRMAEPD
VKAMVAPSQGIHLVFERSFLRGETAIMVPHTSDGRVMFAIPWHGHTVVGTTDTPIDGPSY
EPKPFEQEIEFVLETAGLYLSRKPTRADILSIYVGIRPLVKATETSEKGGQTKTSALSRD
HTIHIDGSGLLTIVGGKWTTYRHMAEDCVNHATTLGTLPDVPCGTRDLHIHGYLPDAEAT
LGEMAVYGSDAAAIEALAVASPELAEKLHTSLPYRKAEVVWAVREEMARTLDDVLARRTR
ALLLNARAAIEVAEDVAKLMARELGRDGAWIAAQVTEFRAMAAQYLPT
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgaagagatgctacagcgaatcaaggcccgtggcgaaaagccctgggacatt
gtcgtcattggcggcggagccaccggcgtaggcgtggccgtcgacgcagccgtgcgtggc
tatgacgtccttttgctcgagcgcgaagacttcggcaaaggcacctcctcacgctccacc
aagctcgtacacggaggcgtgcgttatctcgaacaggggaatgtttcgctcgtgatggaa
gcgctcaaagagcgcggcctgctgcgccagaacgctccgcatctcgtacacgatctgccc
ttcgtcgtgccgaattactcgtggtgggaggcgcccttctacggcatcggcatgaagatc
tacgatctgctcgccgccaaatacagctttggtaaatcgaagatcctcagccgcgaagag
acgatggagcgtctgcccaacatcgaaaccgcaggcctgcgcggcggcgtcgtatatcac
gatggccaattcgacgacacgcgccttctcacgcatcttgcgatgaccgctgcagaccac
ggagcgacgctgctcaactacgctgccgtcacttcgctcactctaggagaagacggtttc
atccagggcgtgatcgttgaagagcgcgagagcggcgaaacgatctccatcgcggcaaag
tctgtcgtcaatgccaccggcatcttcaccgacgaagtccgccgcatggccgaaccagat
gtgaaggcgatggtcgcgcccagccagggcatacatctcgtctttgaacgcagcttccta
cgcggcgagactgcgatcatggtgccgcacaccagcgatggacgcgtgatgttcgctatc
ccgtggcatggacacaccgtcgtaggcaccacggacacgcccatcgacggccccagttac
gagcccaagcccttcgagcaggagatcgagttcgttctcgaaaccgctggcctttacctc
agccgcaaacctacgcgcgcggacatcctcagcatctacgtcggcatccgccctcttgtg
aaagctacggagacgagcgaaaagggcggacagaccaagacctccgcactctcgcgcgat
catacgatccacatcgacggaagcggcctgctcaccatcgtcggtggcaagtggacgacc
tatcgccacatggcggaagactgcgtcaaccacgcgaccacgctcggtacactccccgac
gttccctgcggcacgcgcgatcttcacattcacggataccttcccgatgccgaagccaca
ctcggcgagatggccgtctacggctccgacgctgctgccatcgaagcgctcgcagtggcc
tctcctgagcttgcagagaagctgcacacctcactcccctatcgcaaggccgaagtcgta
tgggccgtgcgcgaagagatggcacgaacgctcgacgatgtactcgcgcgccgcacccgc
gcacttctactgaatgcacgcgctgccattgaagtcgcagaagatgtagccaaactgatg
gcccgcgaactgggacgggacggcgcgtggatcgccgcgcaggtcacggagtttcgtgcg
atggctgcacagtatctgcctacgtaa

DBGET integrated database retrieval system