KEGG   Thermus scotoductus: TSC_c07850Help
Entry
TSC_c07850        CDS       T01414                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
tsc  Thermus scotoductus
Pathway
tsc00260  Glycine, serine and threonine metabolism
tsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TSC_c07850
Enzymes [BR:tsc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     TSC_c07850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C FAD_binding_3 ADH_N_2 HI0933_like FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ADW21411
UniProt: E8PN60
LinkDB All DBs
Position
729475..730506
Genome map
AA seq 343 aa AA seqDB search
MRALAKLAPEEGLTLVERPVPEPGPGEILVRVEAASICGTDLHIWRWDHWARGRIKPPLI
TGHEFSGVVERVGPGVKRPQVGDHVSLESHVVCHACPACRTGNYHVCLNTQILGVDRDGG
FAEYVVVPAENAWVNPKDLPFEVGAILEPFGNAVHTVYAGSGVSGKSVLITGAGPIGLMA
AMVARASGAGPILVSDPNPYRLNFARPYADRLVNPLEEDLLAVVEEVTGSGVEVLLEFSG
NEVAIHQGLKALIPGGEARILGIPSDPIRFDLAGELVMRGITAYGIAGRRLWQTWMQGTA
LVYSGRVDLTPLITHRLPMSQYREAFGLLASGQAVKVILDPKA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctttggccaagctggccccggaagagggcctaaccctggtggaacgccccgtg
cccgagccgggcccgggggagatcctggtgcgggtggaggctgccagcatctgcggcacc
gacctccacatctggcggtgggaccattgggcgaggggccggatcaagcctcccctcatc
accggccacgagttcagcggggtggtagaacgggtgggccccggggtgaaaaggccccag
gtgggggaccacgtgagcctggaaagccatgttgtttgccatgcctgccccgcctgccgc
acgggcaactaccatgtctgcctcaacacccagatcctgggggtggaccgggacggcggg
tttgccgagtacgtggtggtgccggcggaaaacgcctgggtgaaccccaaggacctgccc
tttgaggtgggggccatcctggagcccttcggcaatgcggtgcacacggtgtacgctgga
agcggggtttccgggaaaagcgtcctcatcaccggggcggggcccatcggcctgatggcg
gccatggtggcccgggccagcggggccgggcctatcctggtatccgaccccaacccctac
cgcctgaacttcgccaggccctacgccgaccggctcgtgaaccccctggaggaggatctc
cttgccgtggtggaggaggtgacgggaagcggggtggaggtccttctggagttttccggg
aatgaggtggccatccaccaggggcttaaggccttgatcccggggggggaggccaggatc
ctgggcattccctcggaccccattcgctttgacctggcgggggagctggtcatgcggggg
atcaccgcctacggcatcgcgggaagaaggctctggcagacctggatgcagggcaccgcc
ttggtctactcgggccgggtggaccttactcccctcatcacccaccgcctgcccatgagc
cagtaccgggaggcctttggcctcttggcctcggggcaggcggtgaaggtgatcctggac
cccaaggcctag

DBGET integrated database retrieval system