KEGG   Thermus scotoductus: TSC_c13950Help
Entry
TSC_c13950        CDS       T01414                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tsc  Thermus scotoductus
Pathway
tsc00620  Pyruvate metabolism
tsc00680  Methane metabolism
tsc00710  Carbon fixation in photosynthetic organisms
tsc01100  Metabolic pathways
tsc01120  Microbial metabolism in diverse environments
tsc01200  Carbon metabolism
Module
tsc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TSC_c13950 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TSC_c13950 (ppc)
   00680 Methane metabolism
    TSC_c13950 (ppc)
Enzymes [BR:tsc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TSC_c13950 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 MerR-DNA-bind DUF4350
Motif
Other DBs
NCBI-ProteinID: ADW22014
UniProt: E8PJQ9
LinkDB All DBs
Position
complement(1339550..1342135)
Genome map
AA seq 861 aa AA seqDB search
MKPAKEDTFDLLRAEVDLLGRLLGEAIRAVSGERFFALVEEVRLLSKARRQGDEGARATL
LKRVEGLSLEEAEALVRAFTHYFHLVNLAEERHRVRVNRLRAQAETPESPRPEGFLALAR
ALKERGLSLEEVEAHLNRLELWLTFTAHPTETRRRTLRHHLEKLQEELEAQDRSRLAARV
ALLYATEEVRKARPTVEDEIKGGLYYLPTTLWQAVPRVVEGLEAALEKVYGRRPRLKSPV
RFRSWIGGDRDGNPFVTPEVTAFAARYARQVARERFLLELENLVRDLSLSETKVPVPRGV
REGGEGTERFPGEPYRRFFARLYTRLEKGEASTEELLRALRVAEEGLASVGLEQVAASFL
RPLEARLFAFGLELAPLDLREESGKLLEAAAELLRVGGGHPDFLSLPPEAQEALLTEELR
SARPLLPVGHEPQGEALRVALGAFRAWRDKGAHVVSMTHHPGDLLAVFLLAREVGLYRPG
APLPLDVVPLFETLEDLHRAPEVLTRLLQNPVFLAHARGRGGVEIMIGYSDSNKDAGFLA
ANLALYEAQEALAKVGQSFGLPVFFFHGRGTSTARGGGPAGRAIASLPPRSVGHRIRLTE
QGEALADRYSHPELAVRHLEQLLFHFAQAALGEGVEPRPEWREALWQAGEESMRRYRALL
AQEGFFPFFEAFTPIREIGELPIASRPVYRHGRVREIRDLRAIPWVMAWTQVRLLLPGWY
GLTALEALPLDLLRRMYREWPFFATTLENAAMALAKADLGVAELYLRLVPEKLHSLFHGL
AQEYQKTVTLLESIFQAPLLHNQRTLERQIALRNPYVDPINFVQVELLRRYRAPGGREDE
ALKKALLLSILGVAAGLRNAG
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcctgcgaaggaggatacctttgaccttttgcgggcggaggtggaccttttaggc
cgccttctgggcgaggccatccgggcggtttcgggggagcgttttttcgccttggtggag
gaggtgcgcctcctatccaaggcccgacgacagggggacgaaggagcgagggccaccctt
ttgaagcgggtggaggggctttccctcgaggaggccgaggccctggtgcgggcctttacc
cattacttccacctggtgaacctggcggaggagaggcaccgggtacgggtgaaccgcctt
agggcccaggcggaaaccccggagagcccgaggcccgagggcttcttggccctggccagg
gccttgaaggaaagggggctttccctggaggaggtggaggcccacctgaaccgcctggag
ctatggctcacctttactgcccatcctacagagacccgcaggcgaaccctaaggcaccat
ctggaaaagttacaggaggagctggaggcccaagaccgttcccgcttggcggctagggtg
gccctgctctatgccaccgaggaggtgcgcaaggccaggcccacggtggaggacgagatt
aagggcgggctttactacctgcctaccaccctctggcaggcggtaccccgggtggtggag
ggcctcgaggccgccctggagaaggtctatggcaggcggccccgcctgaagagcccggtg
cgcttcaggagctggatcggaggggaccgggatggcaaccccttcgtcacccctgaggtg
accgcctttgccgcccggtatgcccgccaggtggcccgggagcgatttttgctggaactg
gaaaacctggtgcgggacctttccctttccgaaactaaagttcccgtgcccaggggggtg
cgggagggaggggagggaacggagcgcttccccggggagccctaccggcggttcttcgcc
aggctttatacccgcctggagaagggtgaggcgagcacggaggagcttttgcgggccctg
agggtggcggaggagggcctggcctccgtgggcctggaacaggtggcggcctccttcctc
cgtcccctcgaggcccgccttttcgccttcggcctggagcttgcacccttggacctgagg
gaggagtccgggaaactcctggaggcagcggcggaactcctcagggttggggggggccac
cccgatttcctttccttgccccccgaggcccaggaggccctcctcaccgaggagctgaga
agcgcccgtcccctcctgcccgtgggccatgagccccagggggaggccctgcgggtggcg
ctaggggcctttcgggcctggcgggacaagggggcccacgtggtgtccatgacccaccac
cccggggatctccttgccgtgttccttctcgcccgggaggtggggctttaccggccggga
gcccctttgcccctggatgtggtgcccctctttgagaccctcgaggacctgcaccgggcc
ccggaggtgctcacccgccttctgcaaaaccccgtcttcctggcccacgcccggggccgg
ggcggggtggagatcatgatcggctactccgactccaataaggatgctggcttcctggcc
gccaacctggccctttacgaggcccaggaggccttggccaaggtggggcagagcttcggc
ctgccggttttcttcttccacggccggggtacctccaccgcccggggcggggggcctgcg
ggccgggccatcgccagcctgcctcccaggagcgtggggcaccgcatccgcctcacggag
cagggggaggctctggcggaccgctacagccatcctgagctggccgtgcgccacctggag
caacttctctttcacttcgcccaggcggccttgggcgagggggtggagcccagacctgag
tggcgggaggctttgtggcaggcgggggaggaaagcatgcgccgctaccgggcccttttg
gcccaggagggtttcttcccctttttcgaggccttcacccccatccgggagatcggggaa
ctccccatcgctagccgccctgtgtaccgccacggccgggtgcgggagatccgcgacctc
agggccattccctgggtgatggcctggacccaggtgcgcttgcttttgcctggctggtac
gggcttacggccctggaggccttgcccctggatcttctcaggcggatgtaccgggagtgg
cccttcttcgccaccaccttggagaatgccgccatggccttggccaaggcggacctgggg
gtggcggagctttacctgcgcctggttccggaaaagctacactccctcttccacggcctt
gcccaggagtaccaaaagacggtgacgcttctggaaagcatcttccaggcccccctcctt
cacaaccagaggaccttggaaaggcagatcgccttgcgcaacccctacgtggaccccatc
aacttcgtgcaggtggagcttctccgccgctaccgcgctcctgggggccgggaggatgaa
gccttgaagaaggcccttctcctctccatcctgggggtggcggcgggccttagaaatgcg
ggttaa

DBGET integrated database retrieval system