KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0314Help
Entry
Tsac_0314         CDS       T02137                                 

Definition
(GenBank) Glycosyl transferase, family 4, conserved region-containing protein
  KO
K02851  UDP-GlcNAc:undecaprenyl-phosphate/decaprenyl-phosphate GlcNAc-1-phosphate transferase [EC:2.7.8.33 2.7.8.35]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
tsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tsh01003]
    Tsac_0314
   01005 Lipopolysaccharide biosynthesis proteins [BR:tsh01005]
    Tsac_0314
Enzymes [BR:tsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.33  UDP-N-acetylglucosamine---undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
     Tsac_0314
    2.7.8.35  UDP-N-acetylglucosamine---decaprenyl-phosphate N-acetylglucosaminephosphotransferase
     Tsac_0314
Glycosyltransferases [BR:tsh01003]
 Polysaccharide
  Bacterial polysaccharide
   Tsac_0314
Lipopolysaccharide biosynthesis proteins [BR:tsh01005]
 O-antigen
  Tsac_0314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4 DUF2798
Motif
Other DBs
NCBI-ProteinID: AFK85344
UniProt: I3VS49
LinkDB All DBs
Position
complement(331461..332495)
Genome map
AA seq 344 aa AA seqDB search
MRIYILSFVVAFVAALMATPAAKKLAYKIGAIDIPKDKRRVHSKPVPLIGGLAIYLGTVL
SMLLFLPKSETNIGIIAGSTIIVALGIFDDKYELKAKVKLLGQLLAAFVVVLSGVRIDWL
TNPFGDGMINIGVFAIPLSIFWIVGITNAMNLIDGLDGLAAGIASISSGSLFVVSLLNGR
YATAIITVAVTGAALGFLPYNFNPAKIFMGDTGAMFLGFILSAVSIQGAVKSAAAIAIAV
PILALGVPVFDTIFAIIRRLANKKPIMEADKGHLHHRLLALGLSQRQAVFVMYGVSLFLG
LSAILISSTNGAKGYIILIVAILAVLWGADKMGLYGHKAKNMNV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagaatatacattttgtcgtttgttgtggcttttgtggctgcacttatggctacacca
gcggcaaagaagttggcttataaaattggagccattgatataccaaaggataaaaggcgt
gttcacagtaagccagtaccgcttataggcggattggccatataccttggtacagtttta
agcatgcttttgtttttgccaaagtcagagactaacatcggaataatagctggaagcacg
ataatagtggctttaggcatatttgatgataaatacgaattaaaagctaaagtgaagcta
ttaggacagcttttggcagcatttgtggttgtcttaagcggtgtaaggattgattggctt
acaaacccatttggcgatggcatgataaacattggtgtttttgctattccccttagcata
ttttggatcgtaggtatcacaaatgccatgaaccttattgatgggcttgatggacttgct
gcaggcatagcatctatatcgtctggatctctatttgtagtgtctttattaaacggacga
tatgctactgcgattattaccgttgctgtcacaggagctgcactgggcttcttaccatac
aatttcaatcctgctaagatattcatgggagatactggcgccatgtttttgggcttcatc
ctgtcggcggtgtctatccaaggtgcagtaaaatctgctgctgccattgcgattgctgtt
ccgattttggcgttaggtgtcccggtgtttgacaccatatttgcaataataaggcggttg
gccaataaaaagccaatcatggaggcagataaaggacatttgcatcataggcttttagcg
ctgggcctttcacagagacaggctgtctttgtcatgtacggtgtaagtttgttcttgggt
ttaagcgcaatacttatatcctccacaaatggtgcaaaaggttacatcatattgattgtt
gcgattttagccgtattatggggcgctgacaagatgggactttatggacacaaagctaaa
aatatgaatgtgtaa

DBGET integrated database retrieval system