KEGG   Thermoanaerobacterium saccharolyticum: Tsac_2819Help
Entry
Tsac_2819         CDS       T02137                                 

Definition
(GenBank) ADP-ribosylation/Crystallin J1
  KO
K05521  ADP-ribosyl-[dinitrogen reductase] hydrolase [EC:3.2.2.24]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Brite
KEGG Orthology (KO) [BR:tsh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tsac_2819
Enzymes [BR:tsh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.24  ADP-ribosyl-[dinitrogen reductase] hydrolase
     Tsac_2819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADP_ribosyl_GH PFO_beta_C NgoMIV_restric
Motif
Other DBs
NCBI-ProteinID: AFK94366
UniProt: I3WC15
LinkDB All DBs
Position
pMU3262:99933..100886
Genome map
AA seq 317 aa AA seqDB search
MDTNDKIYGGIYGVAIGDALGSTVEFVNQDFIKKTYGKLTEIIGGGWLNLKPGEWTDDTE
MTLAVSRGIIENKENPFSYIGKEFLQWYKKKPKDIGVTIRTVFEMIRNNRNSLDYDLSDW
LEASKLADSILGGKSAGNGALMRTLPIGIVYKNPYNIYDMAVNIAKMTHWDIRGGLTCAI
YSLSVRNLLDNETDVLSSINKSFDLCEEISDGNNIKELEEIRESFKEADNKNPTGYTVDS
FKCAALSVIEANNFEDAVINAVNLGGDADTIGAIAGGLAGVFWGFKAIPERWISKFSEQQ
RSILNDIAEKLSEIMTQ
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaacgacaaaatttatggtggtatctatggagttgcaataggtgatgcactt
ggatctactgtagaatttgtaaatcaagactttattaaaaaaacatatggaaaactaaca
gaaattattggtggtggatggcttaacttaaaacctggagaatggacagatgatacagaa
atgactttagcagtatcaagaggtattatcgaaaacaaagaaaatcctttctcttacata
ggaaaagaatttctacaatggtataagaaaaagcctaaagatataggtgtaacaattagg
acagtttttgaaatgataagaaataatcgcaacagtttagactatgaccttagtgattgg
cttgaagcttctaaactggcagatagtattctgggaggtaaaagtgcaggtaatggtgca
ttaatgagaacattacctataggtatagtttataaaaatccttacaatatctatgatatg
gcagttaatatagctaaaatgactcattgggatataagaggagggctaacttgtgctatt
tactcactatctgttagaaaccttttggataatgaaacagatgttttaagcagtataaat
aaatcttttgatttatgtgaagaaatttcagatggaaataatataaaggaattagaagaa
atcagagaaagttttaaagaagctgataataaaaatcctacaggatatacagtggacagt
tttaaatgtgctgctttgtctgtcatagaagcaaataactttgaagatgcagttataaat
gctgtaaatttaggcggagatgcggatactattggagcaattgctggcggtcttgcaggt
gtgttttggggatttaaagctataccggaaagatggattagtaaattttcagaacagcaa
cgttctatcttaaatgatattgcagaaaaactttccgaaataatgactcaataa

DBGET integrated database retrieval system