KEGG   Thermococcus sibiricus: TSIB_0615Help
Entry
TSIB_0615         CDS       T00928                                 

Definition
(GenBank) Probable L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00260  Glycine, serine and threonine metabolism
tsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TSIB_0615
Enzymes [BR:tsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     TSIB_0615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACS89680
UniProt: C6A235
LinkDB All DBs
Position
571870..572928
Genome map
AA seq 352 aa AA seqDB search
MEMITLNEKMLGIMKTKPAYGAELVEVDVPNPKEGEVLIKVLATSICGTDLHIYEWNEWA
QSRIKPPQIMGHEVAGEVVEVGPGVHNLKIGDYISAETHIVCGECYQCRTGNYHVCQNTK
IFGVDSDGVFAEYAIVPAQNAWKNPKNIPPEYATLQEPLGNAVDTVLAGSVASKTVLITG
AGPLGLLGITVAKASGASLVIVSEPSEFRRNLAKKVGADVVINPMEEDVVREVKDLTNGN
GVDVFLEFSGAPRALEQGLQAVTPAGRVSLLGLFPKEVTFDINNLVIFKALEIHGITGRH
LWQTWYTVSNLLKSGKLNLDPVITHKYKGFDKFEEAFELMRAGKTGKVVFIP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggagatgataactttgaacgaaaaaatgcttggaataatgaagactaagccagcttat
ggtgcagaacttgttgaagttgatgttccaaatccaaaagagggggaagttcttattaag
gttcttgcgacaagcatttgcggcactgacctacatatttacgagtggaatgaatgggcc
caaagcaggatcaaacctccccagataatgggacatgaagtggcgggcgaggtagtggaa
gtaggtccaggagttcataatctcaaaataggggattatatttctgcggagacccacata
gtttgtggggagtgttatcaatgtaggactggcaattaccatgtatgtcagaatacgaag
atatttggtgtagatagcgatggtgtttttgccgaatatgcaattgttccagcacaaaat
gcttggaaaaatccaaagaatattccaccagagtatgcaactcttcaagaacctcttgga
aacgctgttgatacagttttggccgggtctgttgctagcaagactgttctaattactgga
gctggtccattgggtcttttaggaatcactgttgcaaaggcaagtggggcatcccttgtc
attgtgagtgagccaagtgagtttagaagaaacctcgcaaagaaagtgggtgctgatgtt
gtcataaacccaatggaagaggatgttgtcagggaagtgaaggatttgactaatggtaac
ggtgtagatgtttttcttgaatttagcggtgcgccaagagcccttgagcagggcctccaa
gcagtaacacctgctggtagagtcagtcttttgggattattcccaaaagaggttactttc
gatataaacaatttagtcatcttcaaggccctagagatccatggaataactggaaggcac
ttatggcaaacctggtatacagtttcaaatcttttgaaaagtggaaagcttaacttggat
ccagtcataactcacaaatacaagggatttgataagtttgaagaggcttttgagttaatg
agggccggaaaaacaggaaaagttgttttcattccataa

DBGET integrated database retrieval system