KEGG   Thermococcus sibiricus: TSIB_0872Help
Entry
TSIB_0872         CDS       T00928                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00620  Pyruvate metabolism
tsi00680  Methane metabolism
tsi00720  Carbon fixation pathways in prokaryotes
tsi01100  Metabolic pathways
tsi01120  Microbial metabolism in diverse environments
tsi01200  Carbon metabolism
Module
tsi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TSIB_0872
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TSIB_0872
   00680 Methane metabolism
    TSIB_0872
Enzymes [BR:tsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TSIB_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACS89932
UniProt: C6A2T7
LinkDB All DBs
Position
complement(788919..790376)
Genome map
AA seq 485 aa AA seqDB search
MIFVSLVDYMIPRTMSTQHPDNVYIPFFAHESSLGGEDEVLEAFYAFSVLGVQEQMWDFE
GKEVDEFVIKKLLEKYGQFFKKKKLGRDIRITPRVPNPSVEKAEAKLLLETLESIPRSAD
YAKLFYGEEIAPIFEVILPMTTSSKEIERVYELYKRYIIGKQYKRVYDIKIYEWIGEFYP
EEINVIPLFETKEAILNSHEILKEYLTGKNFEYQRVFLARSDPAMNYGLISAVIYDKYAL
FNIQELEEELSVPIYPIIGVGSAPFRGHFIPENVENTIKEYPNVQTFTVQSSFKYDNDPK
EVIRAIEKVNERKRKKSASVDEGVFKILEKYEKEYTAELKLLAPYIREIAKFVPSRRKRK
LHIGLFGYSRKINGEVLPRAIKFTASLYSLGVPPELLGLSTLSEKDIEELAEYYYGLYRD
LEFALKFFNPKTSQKFKFLNKIVKLQKEMGIEAEERHQTLTSQIISGKFEESVIVQAADI
RGFLG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgatatttgttagtttggtggattatatgatacctagaactatgagcactcaacatcct
gacaacgtctatattccgttttttgcacatgagagttctttgggaggagaagatgaagtc
ttagaagcattttatgcttttagtgtcttgggagtacaagaacaaatgtgggactttgaa
ggaaaagaagtagacgagtttgtaataaaaaagttactggaaaaatacgggcagttcttc
aaaaagaaaaaactaggaagggatataaggattactccccgtgtaccaaatccaagtgtg
gaaaaagctgaagctaaactcttacttgaaacactcgaaagcattcctcgatcagctgac
tatgcaaagttgttttatggggaagaaattgctccaatttttgaggttattctgccaatg
acaacctcctcgaaggagatcgagagagtgtatgaactttacaagagatacattattggg
aagcagtacaaaagggtgtacgatatcaaaatctatgaatggattggagaattctatccg
gaagagataaatgtcattccactatttgaaacaaaagaggccatcctgaattcccatgaa
attctgaaagaatatttaactggaaaaaactttgagtaccagagagtgtttttagccaga
agtgaccccgcaatgaactacggccttataagtgcggtaatatatgacaaatacgcctta
tttaacatccaagaacttgaagaagaattaagtgttccaatttatccaataattggtgtt
ggaagtgctccatttagaggacacttcattccagagaatgtagaaaataccatcaaagaa
tatccaaacgttcagactttcactgtacaaagttcctttaagtatgataatgaccccaaa
gaagtcattagagctattgaaaaagtaaatgagagaaaaagaaaaaagagtgcttctgtt
gatgaaggtgtttttaaaatattggaaaaatatgaaaaagagtatacagcagagctcaaa
ctcctcgcaccctacataagagaaattgcaaagtttgttccttcaaggcgaaaaagaaaa
cttcacataggactctttggatattccagaaaaataaacggtgaggtccttccaagagct
ataaaattcacagcttcactctactctcttggggtaccaccagaactacttggattaagt
acgttaagtgagaaagatattgaagagcttgctgaatactactatggcctttatagggat
ttggagtttgccttaaagtttttcaatccgaaaactagtcaaaaattcaaatttttaaac
aaaatagtgaagttgcaaaaggaaatgggaatagaagcagaagaaagacaccaaacactt
acctcccagataatatctggaaaatttgaagaaagtgttattgtgcaggctgcggacata
agaggtttcctcggttaa

DBGET integrated database retrieval system