KEGG   Thermococcus sibiricus: TSIB_1009Help
Entry
TSIB_1009         CDS       T00928                                 

Definition
(GenBank) Tungsten-containing aldehyde ferredoxin oxidoreductase (AOR)
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00030  Pentose phosphate pathway
tsi01100  Metabolic pathways
tsi01120  Microbial metabolism in diverse environments
tsi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TSIB_1009
Enzymes [BR:tsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TSIB_1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACS90065
UniProt: C6A370
LinkDB All DBs
Position
complement(918330..920147)
Genome map
AA seq 605 aa AA seqDB search
MFGYMGKILRVNLTTGEIKVEELKEEDAKNFIGGRGFASKFLLEEIDPKVDPFSPENKLI
FATGPLTGTTAPTGGRYMVITKSPLTGFIASSNSGGFFGPELKFAGYDMLIIEGKADHPV
YISIKDDDVEIKDASHLWGKRVGETTDKLLEEFGDKKARVACIGPAGEKLVRLANIINDK
HRAAGRSGVGAVMGSKNLKAVVVRGTNQVELADKEKFMSVVKEKIKKIKENPITGGGLPQ
YGTAVLVNIINENGLYPTYNFQTGVFKYAYEQSGEALVAKYLVRNHSCFACPIGCGRVSY
HPAVGVTEGPEYESIWALGATCGINDLASITIANHLCDEFGLDTISTGGTLAAAMELYEK
GIIKQEELGDAPPLRFGNSEVLHYYIEKIAKREGFGDKLAEGSYRLAESYGHPEYSMSVK
KQELPAYDPRGAEGHGVTYATSNRGGCHVRGYMISPEILGVPVKLDPHDVSEEKAKWVKI
FQDLTAVIDSAGLCLFTSFALGADDYAEMLNAATGFEFTTDEWLKAGERVWNLERIFNLK
AGLIPEKDDTLPKRFLEEPMPEGPNKGHVVKLHEILPKYYKLRGWDEKGYPTEEKLKGLD
LDKYY
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggtatatgggaaaaatattgagagtaaacctaacaacgggagaaataaaagta
gaagaactgaaggaggaagacgcaaagaactttatcggtggcaggggttttgcatcgaaa
ttccttctagaagaaatagatccaaaagttgaccccttcagcccagagaacaagttaatc
tttgccaccggacctttgaccggaacaacagctccaacaggcggtaggtatatggtaatt
acaaagtccccattaacgggattcatagcttcaagcaactcaggcggcttctttggaccg
gaactcaagtttgcgggctatgatatgctcattatcgaggggaaagcagatcatccagtg
tacataagcataaaagacgatgacgtggaaattaaagacgcctctcatctatggggtaag
agagttggggaaaccacagataaacttcttgaagaatttggtgacaaaaaggcgagagtt
gcctgtataggccccgcgggagagaagttggttagacttgccaatataataaacgacaaa
cacagggcagctggaagaagtggagtaggagcagtaatgggaagcaagaacttaaaggct
gttgtggtcaggggaacaaatcaggtagaacttgctgacaaagaaaagtttatgagcgta
gttaaagagaagataaagaagataaaggagaacccaattaccgggggaggacttccacag
tatggaaccgcagttctggtaaacataatcaacgaaaacggtctttatccaacgtacaac
ttccagaccggagtattcaagtacgcctacgagcagagcggtgaggctttggtcgcaaag
tacttggtgagaaaccattcgtgttttgcatgtccaattgggtgtggaagagtctcatat
cacccagctgtaggagttaccgaggggcccgaatatgaaagcatatgggcgctcggtgca
acttgcggtataaacgatctggcgagcataacaattgcaaaccacctctgtgacgagttc
gggcttgataccatatcaacaggtggaacacttgcagcggctatggagctttatgagaag
ggcatcataaagcaggaggaacttggggatgcaccaccgttgagatttggcaacagtgaa
gtactccactattacattgagaagattgcgaagagagagggctttggtgacaaactcgct
gaaggaagctaccgtttagctgaaagctatggacacccggagtattcaatgagcgttaaa
aagcaagagcttccggcatatgatcccagaggtgcagagggccatggtgttacctacgct
acctcaaacagaggtggatgtcacgttaggggttacatgatcagcccagaaatccttggt
gtcccagtaaagctcgatccgcacgatgtgagtgaagagaaagccaagtgggttaagata
ttccaggacttaactgcagtcatagactccgctggattgtgtctcttcacaagctttgca
ctcggagcggatgactacgcggaaatgttaaacgccgcaacaggctttgagtttacaacc
gacgagtggcttaaggcaggagaaagagtatggaaccttgagagaatcttcaacctcaaa
gccggtctaatcccagaaaaggacgacaccctacccaagaggttcttggaagagccaatg
ccggagggaccaaacaaaggacatgttgtaaagctccatgaaatccttccaaaatactac
aagctcagaggctgggacgagaaaggatatccaaccgaggagaagcttaaggggcttgac
ttggataagtattattaa

DBGET integrated database retrieval system