KEGG   Thermococcus sibiricus: TSIB_1217Help
Entry
TSIB_1217         CDS       T00928                                 

Definition
(GenBank) putative glycosyl transferase
Organism
tsi  Thermococcus sibiricus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_2 Chitin_synth_2 Glyco_tranf_2_4 Prion_bPrPp
Motif
Other DBs
NCBI-ProteinID: ACS90271
UniProt: C6A3S6
LinkDB All DBs
Position
complement(1107846..1109012)
Genome map
AA seq 388 aa AA seqDB search
MIYPIFVYYIVLTIAGLRYNSRFKRPEIPEELPSVTILIPARNEGLVIRDTLRAMANLDY
PKDKLEVLLLDDGSTDDTAKIAEEVSKDYPFIKVIRVEGGGSGKSYVLNYGLKLAKGEVI
AVYDADNRPEPGALKDLVAMLSDETPAVTGKVKTMNWNRNILTRFICMEYLYFQLAGQAG
KSKFYKTAILPGTNFVIRKELLEELGGWDEEALAEDLELSFRIILTGKKIAYTPLAVTWE
QEPESLRVWFRQRTRWAAGNVHTVKEYVKRFKEIPSWGLRFDLFLTLMVYYLLAMAVIVA
DVAFVALLLTSGSVTWFTWSVLGFVYLAFLLEIFAGLYDGKIKSPGCWLLALLMYHTYSQ
IWILISLAGLWEARRAKKVWYKTPRTAV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgatatacccaattttcgtttactacatagtcctgaccatagctgggctcaggtacaac
tcgcgattcaagaggcccgagattccggaggagcttccttccgtcaccatcctcatcccg
gcccgaaatgagggactggtgataagggacaccctcagggcaatggcaaaccttgactat
ccaaaggataaactggaagttctccttctagacgatggttcaaccgacgacacggcgaag
atagctgaggaagtctctaaggactatccgtttatcaaagtgatccgcgttgagggcggg
ggtagtggaaagagctacgtcctgaactacggcctaaagctggcgaagggtgaggtcata
gcggtatacgacgccgacaacaggcccgagcccggggcgctcaaggatctggtggcgatg
ctgagtgacgagacgccagctgtaaccggaaaagtcaagactatgaactggaacaggaac
atcctcacgagattcatatgcatggaatacctttacttccagctggccggccaggccgga
aagagcaaattctacaaaactgccatacttcccgggacgaactttgttatcaggaaagaa
ctgctcgaagagctcggtggatgggacgaagaggcccttgccgaggacttggagctgtca
ttcaggataatcttaacgggcaaaaagatagcctacaccccgctcgccgtcacctgggag
caggagcccgagagcctgcgcgtttggttcagacagcggacgcgctgggcggcaggaaac
gtccacaccgtgaaagagtacgtaaaacgcttcaaggaaattcccagctggggcctgcgc
tttgacctgttcctcacgctgatggtgtactatctcctggcaatggctgtgatagtggca
gatgtggcctttgtagcactcttattaacctctggaagcgtaacgtggtttacgtggtct
gttttgggcttcgtttacttagccttcctgttggagatattcgccggcctctacgacggg
aagataaagagccccggttgttggctcctcgcgctgctcatgtaccacacgtactcccag
atatggatacttatctcgctggccggcctgtgggaggccagaagggccaagaaagtttgg
tacaagacccccaggacggcggtttag

DBGET integrated database retrieval system