KEGG   Thermococcus sibiricus: TSIB_1321Help
Entry
TSIB_1321         CDS       T00928                                 

Definition
(GenBank) Phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00500  Starch and sucrose metabolism
tsi01100  Metabolic pathways
tsi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TSIB_1321
Enzymes [BR:tsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     TSIB_1321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: ACS90373
UniProt: C6A428
LinkDB All DBs
Position
1188407..1190902
Genome map
AA seq 831 aa AA seqDB search
MEAVINQIKSKLPENLEGLLDLGYNYWWNWNRRATKLWEKINPEHWREYKNPVKLLLDTP
EERLKELSKDDDFINLYELVIDQFRHYMESENTWLSTNWPKWEEPVIYLCMEYGISKSLP
IYSGGLGILAGDHLKTASDLGLPFIGIGLLYKHGYFKQQIDKNGNQIEVFPEYDPHEMPI
KPLTTKKGNPILIEVPIEDRTVYARAFEVNVGRVKLYLLDTDVPENSPDDRTICDYLYNA
EIDKRIKQEILLGIGGMRLLRALGIESAVIHLNEGHPAFANFQRIAWYMEEGLNFLEALT
IVRATTIFTTHTPVPAGHDKFPIVEVEKRLAKFLEGIPKEEFLNLGREGEEFNMTLLSIR
TSSYVNAVSKLHTAVTKEMWKELWKGVPPDEMPVEGITNGVHTKTWLHNEIKKLIDRYIG
RVWRDYAELEGLWYGVERIPNEELWEAHLKAKKELIDLIKRNMKERNKRLGIEEPIPEIN
ENALLIGFARRFATYKRATMIFNDLERLKKIANNPERPVYIIFGGKAHPMDTSGKEFLKR
LYEVSQMPEFKGKIIIFENYDMGSARAMISGVDVWLNTPRRPLEASGTSGMKAGLNGVLN
LSVYDGWWVEGYNGKNGWIIGEESIEPETEGDDITDAESLYELLENEVIPTYYENRQRWI
YMMKESIKSIAPRFSTHRMLKEYVNKFYSKALTNAVLLKRDKFNTTREIATWKAKVLNSW
NKVNIERIITHDAIATEIIVDLDELAPEDVKVEIYYGVKAEGYAIEKPYIIELKRPQHLG
DTKWLYRYKGNALKNLGNPCWHYAVRVYPYHDKLPHKFLLGLIKWKGFFDF
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgttattaatcagataaaatcaaaactcccggaaaatttagaagggcttttg
gacttaggatataattactggtggaactggaatagaagggccacaaaactttgggaaaaa
ataaatcctgaacattggagagaatataagaatcccgtcaagcttcttcttgatactcct
gaggagagactaaaagaactttcaaaagacgatgatttcataaatctgtatgagcttgtt
attgatcagtttagacactatatggaatctgaaaacacttggttatcaacgaattggccc
aaatgggaagaacctgttatatacctgtgcatggaatacggaataagtaaaagtcttcct
atatactctggtggacttggaatactcgcaggagaccatttgaaaactgcaagcgactta
gggcttccttttataggtattggtcttctttacaagcatggatactttaaacaacaaata
gataaaaatggaaaccaaatagaggtatttccggagtatgaccctcatgaaatgccaata
aaacccttaacaacaaaaaagggaaatccaattctcatagaagttccaatagaagataga
acagtttatgcgagagcttttgaagttaatgttggtagggtaaaactttatcttcttgac
acagacgttcctgagaactccccagacgacaggacaatttgtgattatctctacaatgcc
gaaattgataaacgaataaagcaagaaattctccttggtattggtgggatgaggctcttg
agagcattagggattgaatcagcagtgatccatctaaacgaaggacatcccgcctttgca
aatttccaaagaatagcatggtatatggaagaaggtttgaacttcttagaggctctaact
attgtaagagcaactactatttttacaactcatacgccggtaccagctggccatgataaa
tttcccatagtagaagtggaaaaaagattggctaaattccttgaaggaattccaaaagaa
gaatttcttaacctaggtcgtgaaggtgaagaattcaatatgactcttctttcgataaga
acttcaagctacgtgaatgccgtaagcaaactacacactgccgtcaccaaagaaatgtgg
aaagagctctggaaaggcgttcctcctgatgaaatgcctgtagagggcattacaaatgga
gtccatacaaaaacatggctacataatgaaataaagaagctcattgatagatatatcgga
agagtttggagagattatgctgagttggagggcctttggtatggcgtagagagaattccc
aatgaagaactatgggaagcccacctaaaggcaaaaaaagagctcatagacctcatcaaa
agaaatatgaaagaaaggaacaaaagacttggcattgaagagcctataccagaaataaac
gaaaatgcattgttaattggctttgcaaggcgttttgcaacatacaaacgcgcaacaatg
atcttcaatgatttagaaagactcaaaaaaatagcaaacaatccagaaaggccggtatat
ataatttttggaggaaaagcgcacccaatggatacttcaggtaaagaatttctaaaaagg
ctctatgaagtttcccaaatgccagaatttaaaggcaaaatcataatattcgagaattat
gatatgggttcagctagggccatgatatcgggagtggatgtatggctcaatactccccga
cgacctttagaggctagcggaacgagtggaatgaaggcaggccttaatggtgtcctcaac
ctaagtgtttacgatggctggtgggttgaaggatataacggtaagaatggctggattata
ggagaggagagcattgaaccagaaactgagggagatgatataactgatgcagaaagtctg
tatgaattactagaaaatgaggttattcccacatattacgaaaatagacaaagatggatt
tacatgatgaaagagagcataaagagtattgctccacgctttagcacacacagaatgctt
aaagagtatgtgaacaagttctactcaaaggctttaactaatgccgttctcctaaaaaga
gacaaattcaatacaactagagagatcgccacatggaaagcaaaggtgcttaattcatgg
aacaaggttaatatagaaaggattatcactcatgatgccattgctactgaaataatagta
gacttagatgaacttgctcccgaagatgtaaaagttgaaatctactatggggttaaagca
gagggatatgctatagaaaagccgtatataatagaactcaaacgtcctcaacacctagga
gatacaaaatggctctacagatacaaagggaatgctctcaagaaccttggaaatccgtgc
tggcactatgcagtgagggtttatccataccacgataaattgccccataaattcttgctc
ggtcttattaagtggaagggtttctttgacttttaa

DBGET integrated database retrieval system