KEGG   Thermococcus sibiricus: TSIB_1626Help
Entry
TSIB_1626         CDS       T00928                                 

Definition
(GenBank) Tungsten-containing aldehyde ferredoxin oxidoreductase (AOR)
Organism
tsi  Thermococcus sibiricus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACS90677
UniProt: C6A4Y2
LinkDB All DBs
Position
1469887..1471806
Genome map
AA seq 639 aa AA seqDB search
MSKQIKGGYAGKTLWVDLSKNKILIKDLDPELAVNYIGGRGFVAKLLFDLVDPEKDPLDP
QNPLVFATGPLSGIAPASGRFTVGARSPATGIHGDSNSGGDFAMELKHAGYDFIVVTGRA
EEPVYISIQDENVEIKSAKDLWGLTTHETFDRLREKEGDRNIKAVTIGPAGENLVATAAV
IETESRAAARAGMGAVMGSKNLKAISVRGTKDIKIANYEAWKEAFEELLQVFLDDPMTSQ
VGRLLGSNFLHRVHSSHGTLIVENGHRGYATEEELEKVSAESILKYHVKGRSCYLCPIAC
TRSVYMESEKYGVIKGRGPEYYSMQSLTYRAGGWDTEAGIYLNKLCDAYGIDATTLPSNI
AFAIDLYENGIITKEQVGGLELTWGNFDAMEEIIKSVAYRKGKIGELFAKSTKELIKEFG
PESEWYALEVKGLTMPSNDPRAGNVYNMRYAIATRGADHLRVSVLSSGRSLKWDELPEYE
AMEVFVRFETYVTLVNLFNVCNWAYSSYTSTPEIAEIKEKGMFKVYNAATGLNLTPEDFA
KAAHRTIITERAENVRYGLRREHDYLPRRVFEEPLPVNEKGDTKIFPREKFEKLLDAYYA
LRGLDPKTTVPKPSVLRELGLSKIEEDLKLRGLIKEGEQ
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacaaattaaaggtgggtatgcaggaaagaccctctgggttgatttgtctaaa
aacaagattctgataaaagacctcgaccctgaacttgctgtgaactatatcggtggacgt
ggatttgttgcaaagcttctttttgacctagtagaccctgaaaaagatcccctggatcct
caaaatcctctggtatttgctactggtcctctatcgggaatagcccctgcttcaggtaga
tttactgtaggggccagatctccagctactgggattcatggagattctaactctggtgga
gactttgctatggaattaaagcatgcaggttatgacttcatagtggttactggaagagca
gaagaaccagtttacatctctattcaggatgaaaacgttgaaattaaaagtgctaaggat
ctctggggtttaacaacccacgaaacttttgatcgccttagggagaaagaaggagataga
aacataaaagctgtaacaattgggcccgctggagaaaatttagttgcaactgcagctgta
atagagactgagagccgtgccgccgctagagccggaatgggtgcggttatgggctccaaa
aacttgaaagcaatttccgtgagaggaacaaaagacattaaaattgcaaattatgaagct
tggaaagaagcatttgaagaacttctgcaagtgtttttggacgatcccatgacatctcaa
gtggggagattattaggttccaacttccttcatagagtccattcttctcatggcacacta
atcgtagaaaacggtcatcgtggatatgcaaccgaagaggaacttgaaaaggtaagtgca
gagagtatactaaaatatcacgtcaaggggagatcctgttatctctgtccgatagcctgt
acaagatcagtgtacatggaaagcgaaaaatatggagtaataaaaggcagaggcccagaa
tattattcaatgcagtctcttacctatagggccggtggatgggatacagaagctggtata
tacctgaacaaactttgtgacgcatatggaattgatgcaacaacattaccatctaacatt
gcctttgcaatagacctgtatgaaaacggaataataacaaaagaacaggttggagggtta
gagctcacttgggggaactttgatgctatggaagagatcatcaaaagtgtagcctacaga
aagggcaagatcggtgaactatttgcaaaaagtacaaaggaactaataaaagagtttgga
cctgagagcgagtggtatgcattagaggtgaaaggactaacaatgccttcaaacgatcca
agagctggaaatgtgtataatatgagatacgctatcgctaccagaggcgctgatcacttg
agagtttccgtattaagcagtggaaggtctttaaaatgggatgaattgccagagtacgaa
gcgatggaagtatttgttcgctttgagacatatgtaacgttggtaaaccttttcaatgtt
tgtaattgggcctattcttcctacacatctacacctgaaatagcagaaataaaagaaaaa
gggatgtttaaggtatacaacgctgctactggccttaacttaactccagaagattttgcc
aaagctgcacatagaaccattataactgaaagagctgagaacgttaggtacggtcttcgc
agagaacacgactacctcccaagaagagttttcgaagaacccttgcccgtaaatgagaaa
ggggatactaagatcttcccacgtgaaaaatttgaaaaactgcttgatgcatattatgca
ctcagaggccttgatccaaaaacaacagtgcccaaaccttcagttctgagagagctagga
ctctccaaaattgaggaagatctcaaactaaggggtcttattaaggagggagaacaatga

DBGET integrated database retrieval system