KEGG   Thermococcus siculi: A3L11_05935Help
Entry
A3L11_05935       CDS       T05103                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
tsl  Thermococcus siculi
Pathway
tsl00500  Starch and sucrose metabolism
tsl01100  Metabolic pathways
tsl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A3L11_05935
Enzymes [BR:tsl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     A3L11_05935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: ASJ08788
UniProt: A0A2Z2MLW0
LinkDB All DBs
Position
1099770..1102268
Genome map
AA seq 832 aa AA seqDB search
MAEVDTCTCDTIREKLPHPLKGLADLAYNYWWSWNRRATKLWERIDPELWREHKNPVKLL
LDTPESRFKELLRDDDFMNLYELVMDQFEDYMNPDSTWFSTNYPKWDKPIVYLCMEYGIS
RSLPIYSGGLGILAGDHVKTASDLGLPFIAVGLLYKHGYFRQEIDRDGRQREIFPEYKPE
EMPIQPVLGKDGRPLLIEVPIEDRIVYARAFEVKVGRVRIYLLDTDVPENSADDRTICDY
LYNAEMDKRIKQEILLGIGGMRLLKAIGIEPGVVHLNEGHPAFANLQRIAWYMEEGLTFT
EALSIVRGTTVFTTHTPVPAGHDRFPIEEVRKRLAKFLEGRDKLLELGREGDQLNMTLLA
IRTSSYVNGVSQLHAEVSKRMWKDLWPGVPLDEIPIVGITNGVHTMTWVHNEMRKLFDRY
IGKVWREHTNIAGIWYAVERIPDEELWEAHLEAKRQFIELLRRKVLLRNQRLGTDDPLPS
IDENALIIGFARRFATYKRATLLFTDLERLKRLLNDPERPVYLVFGGKAHPRDEAGKEFL
RRVYEVSQMPEFRGKIFVMENYDMGSARLMVAGVDVWLNNPRRPMEASGTSGMKAGLNGV
LNASIFDGWWVEGYNGKNGWVIGEESTEPETEADDPKDAQALYELLEREIVPTYYGNRER
WIYMMKESIKSIAPRFSTHRMVKEYMDRFYSRAMSNHIWLTREDYRGAKEIAAWKDRVTA
SWDAVRFEEVEVGEDGRSVRAVVYLDGLKPEDVQVELYYGVRAEGYNVERPHIIELRHPK
ELGDGRWLYTYEGNALRHLGDPCWHYALRIHPHHEKLPHRFLLGLVKWWSLD
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggttgatacctgcacgtgtgatacaatcagggagaagcttccgcaccccctg
aaggggctggcggacctggcgtacaactactggtggagctggaacagaagggcaacgaag
ctctgggagaggatcgatccggagctctggcgcgagcacaagaatccggtcaagctcctt
ctggacacccccgaaagccgcttcaaagagcttctccgggacgacgattttatgaacctc
tacgagcttgtgatggatcagttcgaggactacatgaaccccgactcaacctggttctcg
accaactaccccaagtgggacaagcccatagtctatctctgcatggagtacggaataagc
aggagcctgccgatctactccggcggtctcggcattctagctggagatcacgtgaagacc
gctagcgacctcggactgcccttcatagcggttggactgctctacaagcacggttatttc
cgccaggagattgacagggacggcaggcagagggagatattcccggagtataagcctgaa
gaaatgccgatacagcccgtcctcgggaaggacggaaggccccttctcatcgaggttccc
atcgaggacaggatcgtctacgcgagggccttcgaggtcaaagtgggcagggttaggata
tacctcctcgacaccgacgtcccagagaatagcgccgacgataggaccatctgcgactac
ctctacaacgccgagatggacaagagaataaagcaggagatactcctcggaatcggcgga
atgaggctcctaaaagctatcggaatcgagccaggcgttgtccacctcaacgagggacac
ccggccttcgccaacctccagagaattgcctggtacatggaggaaggtcttaccttcacc
gaggctctgagcatagttcgcggaaccaccgtcttcaccacccacacgccggttccggcg
ggtcacgacaggttcccgattgaagaggttagaaagaggctcgcaaagttcctcgaaggc
agggataaactccttgaactcggaagggaaggcgatcagctcaacatgacgcttctggcc
ataagaacgtccagctacgtcaacggcgtgagccagctccacgcggaggtcagcaagcgc
atgtggaaggatctctggccgggggttccgctggacgagatacccatagtgggcataacc
aacggcgtccacacaatgacctgggttcacaacgagatgaggaagctcttcgacaggtac
atcggcaaagtgtggagggaacacaccaacatagcaggtatctggtatgccgtcgagagg
attcccgatgaggaactctgggaggcccatctcgaggccaagaggcagttcatagagctt
ctcaggaggaaggttctcctcaggaaccagcgcctcggcaccgacgacccgctcccgagc
atcgacgagaacgcccttataatcggcttcgccaggcgctttgccacctacaagagggcg
acgttgcttttcaccgacctggagaggctcaagaggctcctcaacgacccggagaggccg
gtttacctcgtctttggcggcaaggcccacccgcgcgatgaagccggaaaggagttcctc
aggcgcgtttacgaggtcagccagatgccggagttcaggggcaagattttcgtgatggag
aactacgacatgggcagcgcgaggctgatggttgccggcgtggacgtctggctcaacaac
ccgaggaggcctatggaagcgagcggaaccagcggtatgaaggccgggttgaacggagtt
ttaaacgcgagcatcttcgacggctggtgggttgagggctacaacggaaagaacggctgg
gtcataggcgaggagagcaccgagccggagaccgaggcggacgatccgaaggacgcccag
gccctctacgagctacttgaaagggagatagtcccgacctactacggaaaccgcgagcgc
tggatatacatgatgaaagagagcataaagagcatcgccccgcgcttcagcacccacagg
atggtcaaggagtacatggacaggttctattcaagggcaatgagcaaccacatctggctc
acgagggaggactaccggggggctaaggagatagccgcttggaaggatagggttaccgcc
tcctgggacgcggtgaggttcgaagaggtcgaagtgggagaggacggcaggagcgttcgg
gcggtcgtctacctcgatggactcaagccggaggacgttcaggtcgaactctactacggc
gtcagggcggagggttacaacgtcgagaggccccacatcatagagttgagacatccgaaa
gagcttggggacggaagatggctctacacctacgagggcaacgcgctcaggcacctcggc
gacccctgctggcactacgccctcaggatacacccgcaccacgagaagctgccccacagg
ttcctgctcggcctcgtgaagtggtggagcctcgactga

DBGET integrated database retrieval system