KEGG   Thermococcus siculi: A3L11_06910Help
Entry
A3L11_06910       CDS       T05103                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tsl  Thermococcus siculi
Pathway
tsl00030  Pentose phosphate pathway
tsl01100  Metabolic pathways
tsl01120  Microbial metabolism in diverse environments
tsl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A3L11_06910
Enzymes [BR:tsl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     A3L11_06910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ASJ08969
LinkDB All DBs
Position
1286588..1288450
Genome map
AA seq 620 aa AA seqDB search
MYAYHNKIARVNLTTGKVTYEELPDEVIRKFIGGKGLGYYLIYREVPPGTDPLSPANKFV
FAPGGMTGLVPGSSKVIAVSKSPETRLISDSSGGDAFGPKLKGHFDALIIEGKSEEPVYL
HIHDGKVEIKDASHLWGRGNYEVAKELWKEYPTASMAMVGPAGERLSRIADIIYDTERAS
GRGGLGAVLGSKKVKAVVVEPGEKPKVANPEEFQRLWQEYYDEFATNPKYEHTRTYGTSD
ALRSAASLGMSPTYNFSRPYIPDELASKLGGDEVKKYEIEPEWFVHGKSCPIKCARYVEV
EYKGKKVRVKPEYESIAMLGAATGVFDFPAVAYFIHLVNDYGMDSIATGATIGWLFEMVE
RGLISEDEIGFPVKGFGDAEAEERLIKLMAERKGIGAILADGVKRACERLGRGCEFAVHV
KGMESPAWDPRGRRTYGLSYATADVGASHLRGWPRPHQLPNQGPAKELVPSMIEGRDESY
ITDMLGTCKFVPYKMEDLAKLYSLATGEEWTVEGLRRRAWAIESIARIHDALDWVTPPLD
DTIPPRWWEPEPDGPAKGNAAFIDHNDFIEARREFYRLRGWHEELGVPLPETMEKLGLPE
FKEDAERALEVVKKRVGFRS
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcctaccacaacaaaatagcccgggtgaacctgacgaccggaaaggtgacctat
gaggagcttcctgatgaggtgataaggaagttcatcggtgggaagggtctcggctactac
ctcatctacagggaggttccgccgggtactgaccctctgagtccagccaacaagttcgta
tttgcgccgggaggaatgaccggcctcgttcccggttcgagcaaggtaatcgctgtcagc
aaaagccccgagacgaggctcatcagcgactccagcgggggagatgcctttggtccaaag
ctcaaggggcacttcgatgccctcattatcgaggggaagagcgaggagccagtttatctg
catatccacgacggaaaggtcgagattaaggacgcgagccacctctggggcaggggcaac
tatgaggttgctaaagaactctggaaggaatacccaacggcgagcatggcgatggtcggt
ccagccggggaaaggctcagcagaatagcggacatcatttacgacaccgagagggccagc
ggaaggggcggccttggggcagtcctcgggagcaagaaggttaaagcggtagtcgtcgag
ccgggcgagaagcccaaggtggccaaccccgaggagttccagaggctatggcaggagtac
tacgacgagtttgccacaaaccccaagtacgagcacaccagaacctacgggacgagcgac
gccctgaggagcgctgcttcactcggcatgagtccaacctacaacttctcaaggccttat
attcccgacgagctggcttcaaaactcggcggagatgaggtcaagaagtacgagatagaa
ccggagtggttcgttcacggtaagagctgtcccataaagtgcgcccgctacgttgaggtc
gaatacaagggcaaaaaagtccgcgtcaagccggaatacgagagcatagcaatgctcggg
gcggctaccggtgtcttcgactttcctgctgtggcttacttcatacacctcgtcaacgac
tacggaatggacagcatagccaccggcgcaacgataggctggctctttgagatggtcgag
cgcggtttaatcagcgaggacgagattggcttccctgtgaagggattcggcgatgccgag
gctgaggagaggctcataaagctgatggccgagcgtaagggtataggcgctatccttgcc
gacggtgtcaagagagcctgcgagaggctcggaaggggctgcgagttcgccgtccacgtc
aagggcatggaaagccccgcatgggaccctcgcggcaggagaacctacgggctgagctac
gccacggcagatgtcggtgcctcccacctccgcggctggccgagaccacaccagctcccg
aaccagggacctgcaaaggagctcgtgccctcgatgatcgaaggaagggacgagagctac
atcactgacatgctcggaacgtgcaagtttgtcccatataagatggaagacctcgcgaaa
ctctactcgctcgccacgggagaggagtggaccgttgaagggttgaggaggagggcgtgg
gccatcgagagcatagcgaggatacacgacgccctcgactgggtgactccgccgctcgac
gacaccattccgccgcgctggtgggagcctgaaccggatggcccagctaagggcaacgcg
gcgttcatagaccacaacgactttatcgaggcgagaagggagttctacaggctgaggggc
tggcacgaagagcttggtgtcccactgccggagacgatggagaagctcggccttccggag
ttcaaggaagatgcggagagagcgcttgaagttgtgaagaagagggtggggttcaggagc
tga

DBGET integrated database retrieval system