KEGG   Tsukamurella tyrosinosolvens: ASU32_09480Help
Entry
ASU32_09480       CDS       T05267                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
tsm  Tsukamurella tyrosinosolvens
Pathway
tsm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:tsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ASU32_09480
Enzymes [BR:tsm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ASU32_09480
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ASU32_09480
    1.1.1.-  
     ASU32_09480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AUN40208
UniProt: A0A1H4S1H0
LinkDB All DBs
Position
1952703..1953791
Genome map
AA seq 362 aa AA seqDB search
MRAARYYDRNDVRIEDVPAPEVTDGSVAIDVAWCGICGTDLHEYVDGPIFVPPCGHPNPV
SGEAAPLTIGHEMSGVVAAVGAGVDDLQVGDHVVVEPYIIADDVDTGPASTDYHLSPNMN
FIGLGGRGGGLSERIVVQRRWVHRVSKDVPLDQAALIEPLAVGYHALQRSGAGAGAFALI
TGAGPIGLLTAAVCKAKGLTVAISEPSSLRRSRAAETGVADHVFDPTQVDVVEAVRGLTG
GRGADVGFECTSVQPALDTLFDALRPQAVLVVVSIWGHPGSVDMQKLVLKEIDMRGTIAY
VNNHAETIALVENGTVDLAPFITGRIGLDELVTVGYDTLLHHNETAVKILVSPSGAGLPA
GV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcagcgcgctactacgaccgcaacgacgtccggatcgaggacgtccccgcaccc
gaggtgacggacggctcggtcgccatcgacgtcgcgtggtgcggcatctgcggcaccgac
ctgcacgaatacgtcgacgggccgatcttcgtgcccccgtgcggccacccgaaccccgtc
agcggcgaagcggcgcccctgacgatcgggcacgagatgtccggcgtcgtcgccgcggtc
ggcgcgggcgtcgacgatctgcaggtgggcgatcacgtcgtcgtcgagccgtacatcatc
gccgacgacgtggacaccggccccgcgagcaccgactaccacctctcgccgaacatgaac
ttcatcggcctcggcggccgcggcggcggcctgtcggagcggatcgtggtgcagcgccgc
tgggtgcatcgggtctcgaaggacgtgccgctcgaccaggccgcgctcatcgagccgctc
gcggtcgggtaccacgcgctgcagcgctccggcgccggggcgggagccttcgcgctcatc
accggcgcggggccgatcgggctgctcacggccgcggtgtgcaaggcgaaggggctgacc
gtcgcgatcagcgagccgagttccctgcgtcgcagccgcgcggccgagaccggcgtcgcc
gaccacgtcttcgacccgacgcaggtcgacgtcgtcgaggccgtccgcggcctcacgggc
ggccgcggcgcggacgtcggcttcgagtgcacgtccgtgcagcccgcgctggacacgctc
ttcgacgcgctgcgcccgcaggcggtgctcgtggtcgtgtccatctggggccacccgggc
agcgtcgacatgcagaagctggtgctcaaggagatcgacatgcgtggcaccatcgcctac
gtcaacaaccacgccgagacgatcgcgttggtcgagaacggcaccgtcgacctcgcgccg
ttcatcacggggcggatcggcctcgacgagctcgtcaccgtcggctacgacactctgctg
caccacaacgagaccgcggtgaagatcctcgtctccccgtcgggggcggggctgcccgcc
ggagtctga

DBGET integrated database retrieval system