KEGG   Tsukamurella tyrosinosolvens: ASU32_13990Help
Entry
ASU32_13990       CDS       T05267                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tsm  Tsukamurella tyrosinosolvens
Pathway
tsm00620  Pyruvate metabolism
tsm00680  Methane metabolism
tsm01100  Metabolic pathways
tsm01120  Microbial metabolism in diverse environments
tsm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ASU32_13990
  09102 Energy metabolism
   00680 Methane metabolism
    ASU32_13990
Enzymes [BR:tsm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ASU32_13990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AUN40983
LinkDB All DBs
Position
complement(2867667..2870420)
Genome map
AA seq 917 aa AA seqDB search
MTSDPGRAATEPLRDDIRLLGGILGDTVREQAGPQIFDLVERARQESFAVRRSELDREQL
ASLFADVPTAEAIPVIRAFSHFALLANLAEDLHRERRRAIHVRAGEPPQASSLAHTYGLL
EDAGLDGADVAAALRHALVVPVITAHPTETRRRTVFDTQHRITELMRYRDRTQLDPREEE
RVQVGLRRQILTLWDTALVRLERLRIQDEIENGLRYFDSAFLQVMPAINREARIRLRELY
PGTPLLSEPIVRPGSWIGGDRDGNPNVTDEVVTMASRRAAATALGHYLRELLQLEQELAL
SSRLTTVADELLTLAAWDDSPKRADEPYRRALRGIRGRLTATADALLDEQLDARAEIGAE
PYGGPSELLADLGVVDSSLRAGGDGLIADDRLQALREAVNTFGFHLSGLDMRQNSDVHEE
TIAELFAWAGVHPDYAALDEDERVRLLTAELRLRRPLVGPGAAFSEQTTKELGVLRAAAR
AVESLGARAIPNYIISMCTSVSDLLEAAVLLKEAGLLRPDTDGGAECPVNIVPLFETIED
LQQGAATMRAAFAVPAYRSLVDGKGGLQEIMLGYSDSNKDGGYLAANWALYRAELDLVAM
AREAGITLRLFHGRGGTVGRGGGPSYDAILAQPPGAVRGSLRLTEQGEIIAAKYAEPALA
VRNLESLVAATLESSLLDVEGLGDDAEEAYAVLDELAALARDAYGDLVHRTDGFVEYFKT
STPVEEIGSLNIGSRPSSRKQTSKISDLRAIPWVMAWSLSRVMLPGFYGTGTAFEAWIGG
DPARLERLRDLYRRWPFFRSVLSNMAQVLAKSDLGLAARYADLVPDAALRERVFGKIADE
HRRTIEMYFAITETDDLLADNHALKRSVFNRFPYLEPLNHLQVELLRRYRSGDEDPLVQR
GILLTMNGLATALRNSG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgacccgggccgcgccgccaccgaacccctccgcgacgacatccggctgctg
ggcgggatcctcggcgacaccgtccgcgaacaggccggaccacagatcttcgacctcgtc
gaacgggcgcgccaggagtccttcgccgtccgccggtccgagctggaccgcgagcagctc
gcctccctgttcgccgacgtgcccaccgccgaggcgatcccggtcatccgcgccttctcg
cacttcgccctcctcgccaacctcgccgaggacctgcaccgcgagcgtcgccgcgccatc
cacgtccgcgcgggcgagccgccccaggcctcgtcgctggcccacacctacggcctcctg
gaggacgccgggctcgacggtgccgacgtcgccgcggcgctccggcacgcgctcgtcgtg
cccgtgatcaccgcccacccgaccgagacccgccggcgcaccgtcttcgacacccagcac
cggatcaccgagctcatgcgctaccgcgaccgcacgcagctggacccgcgcgaggaggag
cgggtgcaggtcgggctccggcgccagatcctgacgctgtgggacaccgccctcgtccgg
ctcgagcggctgcgcatccaggacgagatcgagaacggcctgcggtacttcgactccgcc
ttcctccaggtgatgcccgccatcaaccgcgaggcgcggatccggctgcgggagctctac
ccggggacgcccctcctctccgagcccatcgtgcggcccggctcgtggatcggcggcgac
cgcgacggcaacccgaacgtcaccgatgaggtggtcaccatggcgtcccggcgggccgcg
gcgaccgcgctcggccactacctgcgcgagctcctgcagctcgaacaggagctcgccctc
agctcgcgcctcaccaccgtcgccgacgagctgctgaccctcgccgcgtgggacgactcg
cccaagcgcgccgacgagccctaccgccgcgccctgcggggcatccgcgggcgcctcacc
gcgaccgccgacgccctgctcgacgagcagctggacgcgcgcgccgagatcggggcagag
ccctacggcggaccgtcggagctcctcgcggacctgggcgtcgtggactcctcgctgcgg
gccggcggcgacggtctcatcgccgacgaccgtctgcaggcgctgcgggaggccgtgaac
accttcggcttccacctctccggcctcgacatgcggcagaactccgacgtgcacgaggag
accatcgccgagctcttcgcctgggccggcgtgcatcccgactacgccgccctcgacgag
gacgagcgcgtccgtctcctcaccgccgagctgcggctgcgccgccctctcgtgggaccg
ggagctgcgttctccgagcagaccaccaaggagctcggcgtgctgcgcgccgcggcgcgc
gcggtggaatccctgggcgcccgagcgatcccgaactacatcatctccatgtgcacgtcc
gtctcggatctgctcgaggccgcggtgctgctgaaggaggcgggcctgctgcggcccgac
accgacggtggcgccgagtgtcccgtgaacatcgtgccgctcttcgagaccatcgaggac
ctgcagcagggcgccgccacgatgcgcgccgcgttcgccgtgccggcgtaccgctcgctg
gtcgacggcaagggtggactgcaggagatcatgctgggctacagcgattccaataaggac
ggcggctacctcgccgccaactgggcgctgtaccgggccgagctcgacctcgtcgcgatg
gcgcgcgaggccgggatcacgctgcggctcttccacggtcgcggcggcacggtgggccgc
ggtggtgggccgagctacgacgcgatcctcgcgcagccgccgggcgccgtccgcggctcg
ctgcgcctcaccgagcagggcgagatcatcgcggccaagtacgccgaacccgcactggcc
gtgcggaacctggagtccctggtggcggcgaccctcgagtcctcgctgctcgacgtcgag
ggcctcggcgacgacgcggaggaggcctacgcggtcctcgacgagctcgccgccctcgcc
cgggatgcctacggcgacctcgtgcaccgcacggacgggttcgtcgagtacttcaagacc
tccacgcccgtggaggagatcggctcgctgaacatcggttcgcgccccagctcgcgcaag
cagacgtcgaagatctcggacctgcgggcgatcccgtgggtgatggcctggtcgctctcg
cgcgtcatgctgcccgggttctacggcaccggaacggcgttcgaggcgtggatcggggga
gacccggcgcgactggagcgactgcgcgacctgtaccggcggtggcccttcttccggtcg
gtgctctccaacatggcgcaggtcctcgccaagtcggacctcggtctggccgcccgctac
gcggacctcgtgccggacgcggcgctgcgggaacgcgtcttcggcaagatcgccgacgag
caccgccgcaccatcgagatgtacttcgcgatcaccgagaccgacgacctgctcgccgac
aaccacgcgctcaagcgctccgtgttcaaccggttcccgtacctcgagccgctcaaccat
ctgcaggtggagctgctgcgcaggtaccgctcgggcgacgaggaccccctggtgcagcgc
ggcatcctgctgaccatgaacggcctcgcgaccgccctgcgcaactccggctag

DBGET integrated database retrieval system