KEGG   Candidatus Thioglobus singularis PS1: W908_03155Help
Entry
W908_03155        CDS       T04071                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tsn  Candidatus Thioglobus singularis PS1
Pathway
tsn00564  Glycerophospholipid metabolism
tsn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tsn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    W908_03155
Enzymes [BR:tsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     W908_03155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored LolA_like Pyr_redox_2 NAD_binding_8 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ALE01679
UniProt: A0A0M4M288
LinkDB All DBs
Position
613247..614809
Genome map
AA seq 520 aa AA seqDB search
MLKEGEKIYDVFVAGGGINGLGVARDAAGRGYSVCLCEMNDFASGTSSNSTKLIHGGLRY
LEHYKFRLVQESLKEREVLLKMAPHIIWPMRFVLPHSKGMRPAWLLRLGLALYDHLGFRK
ILPGTSSVNLNNGVLESTLKSKYKFGYEYSDCWVDDSRLVILNAVDAAKNGAKLQNYTKV
TKVTKSDGIWLITTTDSIDNTQNTIKAKCFINASGPWVDDVLQESFSNKNTKNVRLVRGS
HIVVNKLYDHDKSFICQNDDGRIFFLIPYEDKFTLIGTTDIDHGRSASEVEISEEEKQYI
CDSANAYLNSEIKLSDIVWSYSGVRPLYDDGASKAQEATRDYVIKAEEHDSSLMINIFGG
KITTYRRLSEAILKHIETFLGQRGGPWTDNSSLPGGDIDVDGLFDLNNKIQEKYPFLNEE
IVKRLVRSYGTVSFDIFPSAKNIESLGESFGSGLYEKEVVYLVQNEWARTSEDILFRRSK
LGLSLTKNEKQKLDQFLEKYQKLSKTSESSVKQDNIAETV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagaaggtgaaaaaatttatgatgtttttgtagccggtggaggtattaatggt
cttggcgttgcaagagatgcagcaggtcgaggttattcagtttgtctatgtgaaatgaat
gactttgcatctggcacatcatctaattcaacaaaactaattcatggtggcctcagatat
ctagagcactataaattccgcttggtacaagagtctctaaaagagcgtgaagtgcttctt
aaaatggcgccccatatcatttggccgatgagatttgtcttgcctcactctaaaggaatg
aggcctgcctggcttttgaggttaggccttgctttatatgatcacttagggtttcgaaaa
atactgccaggtacgagctcagtcaatttgaataatggcgtcttagaaagcacccttaaa
agtaaatataagtttggatatgagtattctgattgctgggttgacgattcaagactggtt
atcttaaatgctgttgatgcagctaaaaatggcgctaaattacaaaactacactaaggta
acaaaagttactaagtctgatggcatttggcttattaccactactgactcaatagataat
actcagaatacaattaaagcgaaatgttttatcaatgcatctggaccatgggttgatgat
gtattgcaagagtcctttagcaataaaaataccaaaaatgttcgtctcgttagggggagt
catatcgttgttaataagctctatgatcatgataaatcctttatctgtcaaaatgatgat
ggtcgaatcttttttttgattccatatgaagataaattcacgttaattggaactacagat
attgatcatggtcgatcagctagtgaagttgagataagtgaagaagaaaaacaatacatt
tgtgattcagctaatgcctatttaaattcagaaatcaaactatcagatattgtttggagt
tattcaggggtcaggcctctttatgatgatggagcaagcaaagcacaagaagccactcgt
gattatgtcattaaagctgaagagcatgactcatcactgatgattaatatttttgggggt
aaaattacgacctaccgccgcctatctgaggccattcttaagcatatcgaaacattcctt
gggcaaagaggtggtccttggactgataattcttctcttccagggggagatattgatgtc
gatgggctatttgacttaaataataagattcaggaaaaatatcctttcttaaatgaagag
attgtcaagcgcttagtcaggtcatatgggacagtctcatttgatatttttcctagtgct
aaaaatatagagtcacttggcgagagttttggctcaggtctttatgaaaaagaggtcgtc
tacctggtccaaaatgagtgggctagaacctctgaagatattttatttagaaggtcaaag
cttggactgtctctaacaaaaaatgaaaaacaaaagctagatcaatttttagaaaaatac
caaaagctgagtaaaacttctgaaagttctgttaagcaagataacatagcggagactgta
tga

DBGET integrated database retrieval system