KEGG   Candidatus Thioglobus singularis PS1: W908_05890Help
Entry
W908_05890        CDS       T04071                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
tsn  Candidatus Thioglobus singularis PS1
Pathway
tsn00061  Fatty acid biosynthesis
tsn00780  Biotin metabolism
tsn01100  Metabolic pathways
tsn01130  Biosynthesis of antibiotics
tsn01212  Fatty acid metabolism
Module
tsn_M00083  Fatty acid biosynthesis, elongation
tsn_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:tsn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    W908_05890
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    W908_05890
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    W908_05890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tsn01004]
    W908_05890
Enzymes [BR:tsn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     W908_05890
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     W908_05890
Lipid biosynthesis proteins [BR:tsn01004]
 Fatty acid synthase
  Component type
   W908_05890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase V-set_CD47
Motif
Other DBs
NCBI-ProteinID: ALE02107
UniProt: A0A0M4LDS0
LinkDB All DBs
Position
1148605..1149390
Genome map
AA seq 261 aa AA seqDB search
MGFLTGKKALIVGVASNRSIAWGIAESMAANGCELAFTYQTEKLKGRVEKCAEICNSSIV
IPCDVSSDKQINETFDELKKSWDSFDILIHSVAFAERAELDGNYLEVTTREGFLKAHEIS
SYSFTALAKSAMPMLNENGALLTLSYLGALRAIPNYNVMGIAKASLEANVRYMAAAMGAE
KGIRVNAVSAGAIKTLAASGIKGFGKLLDHAAESSALKRNVSIEEVGNVAAFLCSDLASG
VTGEVTYVDAGYNFYEKGPDL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggttttttaacaggtaaaaaagcactcattgttggcgttgcttcaaaccgctctata
gcttggggaattgctgaatcaatggcagcaaatggctgtgaacttgcctttacttatcaa
actgagaaacttaaaggtcgcgttgaaaagtgtgctgaaatctgtaactcatctattgta
attccttgtgatgtatccagtgataagcaaattaatgaaacttttgatgaacttaaaaaa
tcatgggatagttttgacattttaattcactcagtggcttttgcagaaagagctgagctc
gatggtaattatcttgaggtcacaacgcgtgaaggattcctcaaggcgcatgaaattagc
tcatatagctttactgcacttgcaaaatcagcgatgccgatgcttaatgagaacggtgcc
ctattaacactgagttacttaggagctcttagagcaattcctaattacaatgtgatgggt
attgctaaagcctctcttgaagccaatgttagatatatggctgcagcaatgggagctgaa
aaaggtattcgcgtcaacgcggtatcagcaggcgcaatcaaaacacttgcagcaagtggc
attaaagggtttggaaaattacttgatcatgctgctgagagctctgcgcttaaacgcaat
gtcagcattgaggaagtcggcaatgtggcagcatttttatgctcagatctagcctctgga
gtaaccggtgaggttacctacgttgatgcagggtataacttctatgagaaaggcccagat
ctttaa

DBGET integrated database retrieval system