KEGG   Trichinella spiralis: Tsp_01738Help
Entry
Tsp_01738         CDS       T01609                                 

Definition
(RefSeq) anaerobic ribonucleoside-triphosphate reductase, beta subunit
  KO
K02358  elongation factor Tu
Organism
tsp  Trichinella spiralis
Brite
Translation factors [BR:tsp03012]
 Eukaryotic Type
  Elongation factors
   Tsp_01738
 Prokaryotic Type
   Tsp_01738
Mitochondrial biogenesis [BR:tsp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Tsp_01738
Exosome [BR:tsp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Tsp_01738
  Exosomal proteins of breast cancer cells
   Tsp_01738
  Exosomal proteins of colorectal cancer cells
   Tsp_01738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 FeoB_N cobW
Motif
Other DBs
NCBI-GeneID: 10911954
NCBI-ProteinID: XP_003377534
UniProt: E5SDC5
LinkDB All DBs
Position
Unknown
AA seq 516 aa AA seqDB search
MIYDVTYMYNQKVSKREIISFEHDFFYAYQRSKSSVRGTVRISFSQHQAKHWISGKPLVV
NPCQHYAVSVKAVYKRDKPHINVGTIGHVDHGKTTLTSAITKILAEKKCATFKKYEEIDN
APEEMSRGITINVAHLEYETEKRHYGHVDCPGHADYIKVRRISNMITGTSQIDGAILVVA
ATEGVMPQTREHLILAKQIGVEQMIIFLNKVDEADAEMVELVETEVRELLGEFGYDADNT
PVIAGSALCALQVCTTAGTVQSDTKPEIGRERVLSLLDAADTWFKIPLRDLDKPFLFPVE
HVYSIKGRGTVVTGKLIRGKMKKGDAFELIGFGSKVKGTVSGIETYHKTVDVGEAGDQLG
LLIKGVSKDDVRRGIVIVPQNAGFKDCVRFEAKTYFLKPEEGGQTKPLANFYSDVAYSLT
WNRPVILQIVDKDLVMPGEDANIIVNLGVPVYVEPQQRFTLRSNCQTVGTGVVTKLLNEV
PAEIVDKKLRKKAMREEVEKLGFNPYSEDVGRKAFV
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgatatacgatgtaacttatatgtataatcaaaaggtgagcaaaagagaaataatatca
tttgaacatgactttttttatgcctaccaacgaagtaaaagcagtgtcagaggaacggtt
aggataagtttttctcaacatcaggcgaagcattggatttctggcaaaccacttgttgta
aatccttgtcagcactatgcagtgagcgtaaaagctgtttacaagcgagataaacctcac
ataaatgttggcactattggtcatgtggatcatggtaaaacaacacttacgtcggcaatt
accaaaattttggcagaaaaaaagtgtgcaacgttcaaaaaatatgaagaaattgacaac
gcaccggaagagatgagccgtggaattacgataaacgtggctcatttagaatacgaaact
gagaaacgtcattatggacacgttgattgtccaggccacgctgattatatcaaagtacgg
cgtatatctaatatgattactggaacttcgcaaattgatggtgctatattagtcgtagcg
gctacggaaggagtaatgccgcagactagagaacatctgatattagcgaaacaaattggc
gtcgaacaaatgattatatttttgaacaaagttgatgaagcggatgcagagatggttgaa
ttagtggaaactgaggtgcgagaattgttaggggaatttggctacgatgcggataatacg
ccagttatagctggttccgcactatgtgcattgcaggtatgtacaacggcaggaactgta
cagagcgatacgaaaccagaaattggtagagagagagtgttgagtttgttggacgctgca
gatacatggtttaagatcccattacgtgatctggacaaaccgtttcttttccctgtcgaa
catgtctacagtattaaagggcgtggtactgttgtgactggaaagctgattcgaggtaaa
atgaagaaaggtgatgctttcgagttgattggctttggctcaaaagtcaaaggcactgta
tcaggcatcgagacctaccacaaaacggtcgacgtcggtgaagccggtgaccagcttgga
ttgttgattaaaggagtaagcaaagatgatgtacgacggggtattgtaatagttcctcaa
aacgctggattcaaagattgcgttcgatttgaagcaaaaacttattttttgaaacctgaa
gaaggaggacaaacgaagccgttggcgaatttttactcggatgtggcgtattctttaaca
tggaatcgaccggtgatattgcaaattgtcgacaaagatttggtcatgccaggcgaagat
gcgaacataattgtaaatttgggagtgccagtgtatgttgaaccgcagcaacgcttcacg
ttgagatccaactgtcaaacagtcggtacaggagtggtcactaaattgctaaacgaagta
ccggcagaaatagtggacaaaaagttgagaaagaaagccatgcgtgaagaagtggaaaaa
ctcggctttaatccatattcagaagacgtgggacgcaaggcttttgtgtga

DBGET integrated database retrieval system