KEGG   Trichinella spiralis: Tsp_02686Help
Entry
Tsp_02686         CDS       T01609                                 

Definition
(RefSeq) maltase 1
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
tsp  Trichinella spiralis
Pathway
tsp00052  Galactose metabolism
tsp00500  Starch and sucrose metabolism
tsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Tsp_02686
   00500 Starch and sucrose metabolism
    Tsp_02686
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Tsp_02686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 10899143
NCBI-ProteinID: XP_003379014
UniProt: E5S1G3
LinkDB All DBs
Position
Unknown
AA seq 551 aa AA seqDB search
MLKYFPFKKFLFLLGITESLEYFEWLGVKAIWLSPVYKSPMIDFGYDICDFRQVDPLFGT
NADLKKLVTELHNRGMYLIMDLVPNHTSDQHPWFEQSKRKQGKYADYYIWVDGKPCSDDQ
LPPEPPNNWESVFGGSAWTWCAERKQFYLHQFLKEQPDLNYRNADVKSEMEQVLQFWLEF
GVDGFRVDAVIYLVEDKEFRDNPLVGRKRRASGTEDCRLTTKGNHTEPKYNVDQPETYEI
VQSWTELMKKFGLNHKKTICCVTEGYSDIEHVMRYYSAGVSFPFNFGLLNWTAETTADEL
VKLVLEWQEHKPTDGWSNWVLGNHDKKRVATRLGGSRFTNMANTLLLLLPGTATCYYGDE
LGMEDTDIPFEKGRDSYGLRAGPERFKEVSRDPCRSPVAWISELPHYGFTKADCDPWLPH
GKNAKQESVDKQRDDHLSHLCYFRRLIQLRSSAVFAESSDNFQLVPCPSQTVFAFTRFKT
GSPTYVIVLNLNRSSETVCADLSAVDDHISEAEVVLDSNNHYKPGESMNLKRLMLNETQA
LVLRFQPSAQR
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatattttccattcaaaaaatttttattcctcctaggaatcaccgaaagtttg
gaatattttgaatggttaggtgttaaagcaatttggctgagcccggtttacaagagtccc
atgatcgattttggctatgatatttgcgattttcgtcaggtggatcctctttttggaact
aatgctgatctgaaaaagctggtgacggagttacacaacaggggaatgtatttgatcatg
gatttagttccgaatcacacttcggatcaacatccgtggttcgagcagagcaaacgcaaa
caaggaaaatacgccgactattacatttgggtagatggtaagccatgcagtgacgatcag
cttccacctgaaccaccgaacaattgggaaagtgttttcggcggatctgcgtggacttgg
tgtgcagaacggaagcagttttatttgcaccagtttttgaaagagcaaccagacttgaac
tatcgaaacgcggatgtgaagtctgagatggaacaagtgttgcagttttggttggaattt
ggagtggacggatttagagtggacgctgttatttatttagtcgaagacaaagagtttcgt
gacaatccacttgttgggcgtaagcgtcgagcatccggcaccgaagactgtcgactaact
accaaaggtaatcatacagaaccgaagtacaatgttgatcagccggagacgtacgaaatt
gtccaaagttggacagagttgatgaaaaaattcggcttaaatcataagaagacaatatgc
tgcgttaccgaaggttacagtgatattgagcacgtgatgcggtattattcggcaggcgtt
agctttccgttcaattttgggttgctcaactggactgccgaaacaacggcagatgaactg
gtgaagctggtacttgaatggcaagagcacaaaccgaccgacggttggtcaaattgggtt
ttgggaaatcatgataaaaaacgtgtagccacaagactcggtggctctcggtttacgaac
atggcaaacacgttacttttactgttgcccggcactgcgacctgctattatggagatgag
ctcggcatggaagatactgacataccttttgaaaagggtagagattcttacggtctacgc
gcaggaccagaacggttcaaagaagttagtcgagatccttgcaggtcgcccgttgcctgg
atttctgaacttcctcactatggcttcaccaaagccgactgtgatccgtggcttccacat
ggcaagaacgcgaaacaagaatcagttgacaaacaacgcgatgatcatttgtctcatctg
tgttatttcagacgtttgattcagcttcgctcttctgcagtgttcgctgaatcatccgac
aactttcagcttgttccttgtccttcacagacagtatttgcattcacccgcttcaaaacc
ggctctcctacgtatgttattgtactgaatttgaatcgttcaagtgagacagtttgtgcc
gatctatccgcagttgatgatcacatctctgaagctgaagtggtattagactcgaacaat
cattacaaaccaggcgagtcgatgaatttgaagcgcctaatgctcaacgaaacgcaagcg
cttgtgcttcgattccaaccgtccgcccaacggtaa

DBGET integrated database retrieval system