KEGG   Trichinella spiralis: Tsp_03950Help
Entry
Tsp_03950         CDS       T01609                                 

Definition
(RefSeq) glycosyl hydrolase, family 31
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
tsp  Trichinella spiralis
Pathway
tsp00052  Galactose metabolism
tsp00500  Starch and sucrose metabolism
tsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Tsp_03950
   00500 Starch and sucrose metabolism
    Tsp_03950
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Tsp_03950
    3.2.1.20  alpha-glucosidase
     Tsp_03950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 10904042
NCBI-ProteinID: XP_003374761
UniProt: E5SHN1
LinkDB All DBs
Position
Unknown
AA seq 856 aa AA seqDB search
MCKVALITDCFLLVLLCQTIPILNGSIILDCHPDPMATMEQCQSRGCVWQASSEPNVPWC
RFFDNPQDPHFAGYEITSNDHFTETVAPYFVANLKRKPTPTLFGDDFHQALMKVESLSDS
IISITFTSNHSVDAAGHHVHHVHLDTALNNFRQAVSNKAPVDPLYRLYLDQDPFGFAVVR
NKTGRVLVDSRNLPGFTLAEQYSQLAFKVPSEDLYGLGENVHEQLKHNFQWRRWTMMARD
HPPEGGPSNLYGVHPFYLCMEDEEGNAHGVFIFNTHAMDVTLQPDPSVVTFRTIGGPLQL
FVMLGPTPAQVVSQYLTLVGNPNFPPYWSLGFHLSRFGYKNLTMLAEVVERNRNANIPQD
GQFLDIDYMKNRMDFVVDDDNFKNLNNFVDQLHQQYQMKLIPIIDPGIPSQPEQPYEPVE
HGLKMDIFIKDANTGQPLEGVVWPGKTYWPDFTNPDTVTYWTYFLKRLHKTVSFDGIWID
MNEPANFVDGSTSGCTQNKLNQPPYNPAAGNILEKTICMDADQYLGKHYHLHNIYGLSES
IVTHTALSNIIPGKRPFILSRSTFSGSGQFANHWSGDNWSQWSHMRWSIINMLEFQLFGI
PMTGSDICGFNGNADEELCLRWSQLGAFYPFSRNHNTDNSDVDQDPASWSPETTAAIRKV
LLLRYSLLPYLYTLFFWAHFVGATVVRPLFFEYPADKTARTIDDQFLWGSSLMIVPILEP
YSTLREAYFPAGRWRNPINLLICLDEEQRAVGNLFWDDGEAYDSVVENKHTLVDLKFEET
RKFQLTAVHYYTELTVDKVVVLGLQGGLPAGATLDGQRLPSKHFQIDPDKTILSLLHLNI
TFSASSFVHLIELVDE
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaaagttgctctgatcaccgactgctttcttcttgtgctactttgccaaacgatc
ccgattttgaatggcagcataattctcgactgccatccggatccgatggccacgatggaa
cagtgccaaagtcgcggatgcgtctggcaggcgagctctgagccaaacgtaccttggtgt
cgatttttcgacaatccacaagatccccactttgccggctacgaaatcacctcgaacgac
catttcactgaaacagtggcgccgtattttgtagccaatttgaaacgcaaaccaacgccc
acgcttttcggtgacgattttcaccaagcactgatgaaagtggaatcgttgtccgattcg
atcatcagcatcacattcacttctaatcacagcgtcgatgctgctggtcaccatgttcat
catgttcacttggatacggctttgaacaattttcgacaagcggtctcgaacaaagctccc
gtcgatccattgtacaggctctatttggatcaagatccgttcggttttgcagttgttcga
aacaaaactggccgagtgttggttgattcgagaaatttgcccggcttcacgttagccgaa
caatattcccaattggcgttcaaagttccatccgaagatctgtacggtttgggtgaaaat
gtccacgaacagttgaagcacaatttccaatggcgccggtggacaatgatggcgcgcgac
catccgcccgaaggcggtccgtcaaatttgtacggtgtgcatccgttctatttgtgcatg
gaagacgaagaaggcaacgcccacggtgtgttcattttcaacacgcacgccatggacgtc
accttgcaaccggacccgtcggtcgtgacgttccgcaccattggcggaccgttgcaatta
ttcgtcatgctcggtccaactcctgcccaagtggtcagccaatatttgacactggtcggc
aatcccaactttccaccctactggtcgttgggatttcacctcagtcgtttcggttataaa
aatttaaccatgcttgccgaagttgtcgaacgcaatcgcaacgccaacattccgcaagat
ggtcaatttttggacattgattatatgaaaaatcgtatggattttgtcgtcgatgatgat
aatttcaaaaatttgaacaatttcgtcgatcaactccaccaacaatatcaaatgaaatta
ataccaataatcgaccccggcattccaagtcaacccgaacaaccgtacgaacctgtcgaa
catggtctgaaaatggacattttcatcaaagatgcaaataccggacaaccgttggaaggt
gtcgtgtggcccggcaaaacctactggccagattttacaaatcccgacacggtcacttat
tggacgtattttttgaaacgcctccacaagacagtgtcgttcgacggaatttggatcgac
atgaacgagccggcaaattttgtcgacggttccacaagcggatgcacgcagaacaaactc
aaccaaccgccgtacaatccggcggcgggcaatatattggagaaaacaatttgcatggat
gccgaccagtacctcggcaagcattaccatttgcacaacatttacggcttgtccgaatcc
atagtcacgcacacggcgttgtcgaacatcatcccaggcaaaaggccgttcattttgagc
cgttccactttctcaggatcgggtcaatttgccaatcactggtcgggcgacaattggagc
caatggtcacacatgcgttggtcgattatcaacatgctcgaatttcaactgttcggcata
ccgatgaccggatcggatatatgcggtttcaacggcaacgccgacgaagagctctgcttg
agatggtcccaattgggagcgttctatccgttcagccgcaatcacaacaccgacaacagc
gacgtggatcaagatccggcttcgtggtcgccggaaacgacggcagcaattcgcaaagtg
ctcctgctccgctacagtctactaccctatttgtacacgttgttcttttgggctcacttt
gtcggcgccaccgttgtcagaccgttgtttttcgaatatccggccgacaaaactgcccgt
acaattgacgatcaatttctctggggatccagtctgatgatcgtacccatactggaaccg
tacagtacactgagagaagcgtattttccggccggacgctggcggaatccgatcaacttg
ctgatttgtttggacgaagagcaaagagccgtgggaaatttgttctgggacgacggcgaa
gcttacgattcggtggtggagaacaagcacacgttggtcgatttgaaattcgaagaaacc
agaaaattccaactgaccgctgtccactattacaccgagttgactgtggacaaagtggtc
gtgctcggtctccagggcggattgccggccggggcgaccctagacggccaacgcctgcct
tcgaaacattttcaaatcgatcccgacaaaaccatcctaagtctactccatttgaacatc
accttttccgcctcttcattcgtgcatcttatagaattggttgacgaataa

DBGET integrated database retrieval system