KEGG   Trichinella spiralis: Tsp_05200Help
Entry
Tsp_05200         CDS       T01609                                 

Definition
(RefSeq) putative DNA-repair protein
  KO
K10846  DNA excision repair protein ERCC-5
Organism
tsp  Trichinella spiralis
Pathway
tsp03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:tsp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    Tsp_05200
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tsp03400]
    Tsp_05200
DNA repair and recombination proteins [BR:tsp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     Tsp_05200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I Imm49
Motif
Other DBs
NCBI-GeneID: 10908940
NCBI-ProteinID: XP_003369790
LinkDB All DBs
Position
Unknown
AA seq 859 aa AA seqDB search
MIFKKVFSKGNILTKMTLNIVSTHNQAFSADEFLRCNICRKLYKIFSMHLVTITGLTVNI
AVAHRSGQKTVNVMGVKGLWKILDAASKPVTLESLSGKILAVDLSIWLHQAVHVNFGSER
HSIFEGPKAHLQILFFRLLKLLFYGIRPIIVFDGPEISILKKRTQIRRRIKLNESFTKSR
KLQQKMLKVLAAKAADRFESTINENMTAHEASSALINAESTSSVQDIEKIERLQTSQDDH
FDEDMWSYSNNEILLDGIDLKTVNELPLELQYEIYAAMKSQPSKLNVPSVSGAFSNYQIN
ELLKRNEIDDKLAKLREEIILSDPLLTLNVHEAEKSTCAVKVKKLISRDNRHHIIFDREE
KTVEDSKLTKPFENLENDIIPNCVTFDGNECEEMLFDDFIPGNDDVNYDENVKFIEERPC
ELFANCKTLNDDLTNDSAGSSIVDVSSSIEASEPAFEKERYPSENEFTQQILSTAASDEL
CDSEENKETFIECQSDDSDSFVEVEELSEEHLHDMLNETLKSEKIAENDFSDCVVLETKS
VVANDVADIHWTGDFQKLESEHSRAEAGARTVTSQILDECEVFLRLFGVPIVKSLAEAEA
QCAWLEQNQISEGTITDDSDIWLFGGQHVYRNLFVKKKLVQYFDMNTIKELSSLINCIAH
PVFSALNREKFILLAMLVGCDYSQGVENLGVVTALEIIAEFNSAAEQSTPIETLVSFRQW
FQSAPLPGESTFRTRLRKLCCHFPGTFPDQCVYDAFLNPKVNHFHAEDFKWNLPDLDAIR
RYAEENFNWSKEKTDQHLLPVMKKLGRTHCENQSRISSHFLPITIDVKAKQSKRMKVLIN
KMKRNETNDDVADSSDCVL
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgattttcaaaaaagtatttagtaaaggaaatattttgaccaaaatgacattaaatatt
gtgtccactcacaaccaggcattctcggctgatgaatttctgcgctgtaatatttgtaga
aaattatataaaatcttcagcatgcatttagttaccataaccggcttaacagtaaatata
gcagttgctcaccgttctggacagaaaacagtaaatgttatgggtgttaaagggttgtgg
aaaattttggatgctgcctctaagccggtcactcttgaatctctttccgggaaaatatta
gctgttgatttgtcgatatggttgcatcaggccgttcatgttaattttggttcagaacgg
cattcgatttttgaagggccaaaagcacatcttcaaattttattttttcgtctgctgaag
ctgttattttatggaattcgaccaataattgtttttgatggcccagaaatttctattttg
aagaaacgtacacagatacgacggcggataaaattgaatgaatcatttaccaaaagtaga
aagttgcagcaaaagatgctcaaggtattggctgccaaagctgctgatcgttttgaatct
acaataaatgaaaatatgactgcgcatgaagcaagcagtgcattaattaatgcggaaagt
acttcatccgttcaagatattgagaaaatcgaaagattgcagacttcacaggatgatcat
tttgatgaagacatgtggagttatagtaataatgaaattctgttggacggaattgattta
aaaactgtaaacgaattgccacttgaattgcagtatgaaatttatgcggcaatgaaatcc
cagccgtctaaattaaatgtaccttcggtttcaggtgctttttctaattaccaaattaac
gaattgctgaaacgaaacgaaattgatgataaattagctaaacttagggaggaaattata
cttagcgatccgttgcttacgttaaacgtccatgaagcagaaaaatcaacatgcgccgta
aaagtgaaaaaattgattagtcgagataatcggcatcatataatttttgatcgtgaagag
aaaactgttgaagacagtaaactaactaaaccgtttgaaaatcttgaaaatgacattata
cccaactgtgtaacatttgatggaaatgaatgtgaagaaatgctttttgatgattttatt
ccaggaaatgatgatgtaaattatgatgagaatgtaaaatttattgaagaaagaccgtgt
gaattatttgcaaactgtaaaacactgaatgatgatttaacaaacgacagcgcaggcagt
tcaattgttgatgttagttcttctattgaagccagtgaacctgcgtttgaaaaggaaaga
tatccgtctgaaaatgaatttacgcaacagattctatcaactgctgcaagtgatgaactt
tgtgattcagaagaaaataaggaaacattcatagaatgtcagtctgatgatagtgacagt
tttgtcgaagttgaggaattgtctgaagaacatctgcatgatatgttgaatgaaacttta
aaatctgaaaaaatagctgaaaatgatttttccgactgcgttgttttggaaacgaaatct
gttgttgcaaacgatgttgcggatattcactggactggtgattttcagaagttggaaagc
gaacattcgcgagctgaagctggcgcgcgaacggttacttcacaaattttagacgaatgt
gaggtttttttgcggctttttggcgtaccgatcgtgaagagtctagcagaagcagaagct
cagtgtgcttggttagagcagaatcaaatttccgaaggtacgataactgatgattcggat
atttggctatttggcggtcaacatgtatatcgtaatttatttgtcaagaaaaaattggtg
caatattttgatatgaacactataaaagaattatcatcattaattaattgtattgcgcat
cctgtgttttcagcactgaacagagaaaagtttattttactagctatgctagttggttgt
gattattctcaaggtgtggaaaatctcggtgtagttacagcattagagataattgccgaa
ttcaacagtgcagccgaacaaagtacaccaatagaaacactggtcagttttcgacagtgg
tttcaatctgcacctttgccaggagagtcaacgttcagaacacgtctgcggaaattgtgt
tgtcactttcctggcacatttccagatcagtgtgtatatgatgcttttttgaatccaaaa
gttaatcattttcatgctgaagattttaaatggaatttgccggatttggatgctattcga
cgatacgcggaagaaaattttaattggagtaaagaaaaaaccgatcaacatcttttgcca
gtgatgaaaaaattaggaaggacgcattgtgaaaatcagagccgaatttccagtcacttt
ttgcccatcactattgacgttaaagcaaaacagtcaaaaaggatgaaagttttaattaac
aagatgaaaagaaatgaaacaaatgacgatgtcgccgatagttcagattgcgttttatga

DBGET integrated database retrieval system