KEGG   Trichinella spiralis: Tsp_05972Help
Entry
Tsp_05972         CDS       T01609                                 

Definition
(RefSeq) adenosine 3'-phospho 5'-phosphosulfate transporter 1
  KO
K15276  solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2
Organism
tsp  Trichinella spiralis
Brite
Transporters [BR:tsp02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   Tsp_05972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L15e UAA EamA
Motif
Other DBs
NCBI-GeneID: 10911189
NCBI-ProteinID: XP_003380247
UniProt: E5S506
LinkDB All DBs
Position
Unknown
AA seq 726 aa AA seqDB search
MWVLDDAEFFTTSENYTATFISSFTEFWLFRFVDDCMTYAMVLLPCYLFVACFKDEKFET
DGNVEGRFNNFFLSILFYGRKFSNKSKMIQASDSEHSNVSTLFSTFLRLCFCFVGLQVTY
ITWGVLQEKVMTQNYIRRNSAVSNVRSYDGFQDSEFLVFFNRLIAFLISTAVFLLTKPDA
VIAPLYEFSYASLANILSSWCQYEALKFISFPAQVLFKCSKVVPVMLMGKVVQRKIYSRH
DYTCALMIAIGVSLFMLFGGKHSSSRSTESVTVSGITLMIGYLVFDSFTSNWQNVLFDKY
KISSLQMMSGVNMFSCVLTLISLIRQGRLFSSFRFITQHDNFGEDLLLSSLSGAVGQFFI
FYTIRHFGAVGFTLMMTIRQALSILISCILYKHDITELGILGIAMQCNLCSVTDFYCIIS
CSPSTGMIYCYECSLYDWACLRSCRTVPHISAIYCEACTAWDFLCFSVCVPSPTIIKRKV
QVFSMAYDETNFNMPVKFTFLCEMGAYRYMQEIWRKKQSDVMRFLLRVRTWHYRQLSAIH
RASRPTRPEKARRLGYVAKQGFVIYRVRVRRGGRKRKVTKGQTYGKPKNHGVNQLKMKRS
LQSIAEVLIYLFTEFSGAKRELKFQQRVGRRCGALRVLNSYWVGQDSTFKFYEVILVDPM
HKAIRRDPDLQWICKPTMKHREMRGLTKAGKRSRGLGKGIGYSQTIGGSRRKAWKRRNTL
SLRRKR
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgtgggttctggacgacgcggaatttttcactactagcgaaaattatactgcaacattt
atatcgtcatttactgaattttggttatttcgttttgttgacgactgcatgacatatgct
atggtgcttttgccttgttacctttttgtagcgtgtttcaaagacgaaaagtttgaaaca
gatggaaatgttgaaggaagatttaataacttttttttaagcatattgttttatggtcga
aaattttctaacaaatccaagatgatacaagcttctgattctgagcactcgaatgtttca
actctgttttctacatttttacgtttgtgcttttgctttgtcggtcttcaagttacgtac
ataacgtggggtgttctgcaagagaaggtgatgactcagaattatattaggagaaattcg
gctgtaagcaatgtcagatcgtacgatggttttcaagattcagaatttttggtatttttc
aatcgactgattgcatttttaataagcactgctgttttcttgttgaccaagccagatgca
gtgattgcaccgttgtatgaattttcttacgcatccttggcgaacatcttgagcagttgg
tgtcagtatgaagcgttgaaattcatttcttttccagctcaagtgttattcaaatgctca
aaagtggttccggtgatgttgatgggtaaagttgtccaaagaaaaatttattcccgccac
gactatacgtgcgctttgatgatagctattggcgtgtcgttgttcatgctgttcggtgga
aagcattcgtcttcacgttccactgaatccgtaacagtttccggaattacattaatgatc
ggctatttggtatttgatagctttacaagcaactggcaaaatgtgttgttcgacaaatat
aaaatatcatctttgcaaatgatgagcggtgttaatatgttcagttgcgttttaacactg
atatcacttatcagacaaggacggttgttttcttcatttcgattcataacgcagcatgat
aactttggtgaagatttgttactttcttctttatctggtgctgtgggacagtttttcata
ttttataccattcgtcactttggtgccgtcggttttactttgatgatgaccataagacag
gcgctttccattcttatttcttgcattctttacaagcatgacatcactgaattaggcata
ctgggaatagcgatgcagtgtaatctatgttcagtgactgacttttattgtattatctcg
tgttcaccgtctactggaatgatttattgttatgaatgttcgctttacgattgggcatgc
ctcaggtcttgtcgtaccgttccgcacattagtgcaatctactgcgaagcatgcaccgcc
tgggattttttatgcttctctgtttgtgttccttcaccgactattataaaacgtaaagta
caagttttcagcatggcatatgatgaaacaaattttaatatgcccgtaaaatttactttt
ctttgtgagatgggtgcctaccggtacatgcaagagatatggagaaagaagcagagtgac
gttatgcgttttttgcttcgagttcgaacctggcattatcgacagttgtcagctatacac
cgcgcatcgcgaccaacacgtccggaaaaagcaaggcgtcttggatatgttgctaaacaa
ggttttgtaatatatcgagttcgtgtaagacgaggtggtcgtaaacgcaaggttaccaaa
ggtcagacttatgggaaaccaaaaaatcatggtgttaaccagttgaaaatgaagcgaagt
ttgcagtcaattgccgaagtattaatttatttgttcacagaattctcaggtgctaaaaga
gaattgaaatttcagcaacgagttggtcgtcgatgtggagctttgcgagtgttgaattct
tattgggttggccaagattcaacatttaaattttatgaagtgattttggtcgatccgatg
cataaagcaattcgtcgtgatccagatttacaatggatttgtaagccgactatgaaacat
cgtgaaatgcgtggcttgacaaaggcgggaaaaagatctcgcggtttaggaaaaggcatc
ggatattcccagactattggtggtagcagaagaaaagcatggaaacgtcgaaacacttta
tcattgcgaagaaaacgttaa

DBGET integrated database retrieval system