KEGG   Trichinella spiralis: Tsp_06232Help
Entry
Tsp_06232         CDS       T01609                                 

Definition
(RefSeq) arginine kinase
Organism
tsp  Trichinella spiralis
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN DUF4528 DUF745
Motif
Other DBs
NCBI-GeneID: 10908279
NCBI-ProteinID: XP_003378280
UniProt: E5SFH9
LinkDB All DBs
Position
Unknown
AA seq 408 aa AA seqDB search
MRSEMAFSRLSKTSKIVVLTTGGALLAGIGTFYYRMGDELRKNLLNIETVPKDIQKRCDE
AYEILQNAKDCHSLLKKHLTKSVLDSLKTQKTKMGGTLIDVINSGVKNLDSGIGVYATDP
EAYHVFKKLFDPVIADYHKFNPKDKQPKENFGENELNKFENLDPKGKYILSTRIRCGRTL
KGYPFNPLLREDDYLLIEQKMKEALNSFTDSELQGKYYSLSGMSESDKKQLIKDHFLFKE
GDRFLQVSLAAKACQYWPVGRGIFHNNAKTFLVWINEEDHVRIISMQQGGDVKAVFSRLI
RGVKDIEKKVSFAKDDRLGNVTFCPTNLGTTIRASVHIKLPKLSTRSDFKEVCEKLNLQV
RGIHGEHSESEGGIYDISNKRRMGLTEFEAVKEMYDGVKKLIYMEEKA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccgaaatggcgttttcaagattaagcaagacttccaaaatcgtggtgcttact
actggcggagcacttttagctggaattggtactttttactacagaatgggcgatgaattg
agaaaaaatttgctgaacatcgagacagtgccgaaggatattcaaaagcgttgtgatgaa
gcttatgaaattcttcaaaatgcgaaggattgtcattctctgttgaaaaagcacttgacc
aaatctgttctcgacagcttgaagacacagaaaaccaaaatgggaggaaccctgattgac
gtaatcaattctggtgtgaagaatctggatagtggtattggagtgtatgcaacagatccg
gaagcgtaccatgttttcaagaagctcttcgatcctgtcattgcagattatcacaagttt
aacccaaaggataaacaaccgaaggaaaattttggcgaaaatgagctgaataaatttgaa
aacttggatccaaaaggaaaatacattttatcaacacgaattcgttgcggtcgaacgttg
aagggttatcctttcaatccacttctacgagaggatgattatcttcttattgaacaaaaa
atgaaagaggcactgaattcttttactgattcggaacttcaaggaaaatattactcactt
tctggtatgagcgaaagtgacaagaagcagctgattaaagatcactttttgttcaaagaa
ggagatcgctttcttcaagtgagcctagcagctaaagcttgtcagtattggccagttggt
cgaggtatattccacaacaatgcaaaaacattcttggtatggattaatgaagaagaccat
gtacgcattataagtatgcaacaaggaggtgatgtcaaggcggtctttagtcgtttgatt
cgaggagtaaaagatattgaaaagaaagtttcttttgccaaagatgatcgtcttggtaat
gttactttttgtccaactaatttgggtacaactattcgggcgtctgtgcacatcaaattg
ccgaagctgagcaccagaagtgatttcaaggaagtatgtgaaaagttaaacttacaagtg
cgtggcattcatggagagcattcagaatccgaaggtggcatttatgatatcagcaacaaa
cgtcgtatgggattgacagaatttgaagcggtgaaagaaatgtatgatggtgtcaagaaa
cttatttacatggaagaaaaggcttaa

DBGET integrated database retrieval system