KEGG   Trichinella spiralis: Tsp_06974Help
Entry
Tsp_06974         CDS       T01609                                 

Definition
(RefSeq) succinate dehydrogenase, flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tsp  Trichinella spiralis
Pathway
tsp00020  Citrate cycle (TCA cycle)
tsp00190  Oxidative phosphorylation
tsp01100  Metabolic pathways
tsp01200  Carbon metabolism
Module
tsp_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tsp_06974
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Tsp_06974
Enzymes [BR:tsp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Tsp_06974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C PS_Dcarbxylase Thi4 Pyr_redox_2 FAD_binding_3 DAO GIDA HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 10903265
NCBI-ProteinID: XP_003380827
LinkDB All DBs
Position
Unknown
AA seq 765 aa AA seqDB search
MMSKLSSVNVNLLKRCLFFNPQAYSSYESRRFVSGYEIVDHTYDAVIVGAGGAGLRAAMG
LVEAGFKTAVVTKLFPTRSHTVAAQGGVNAALGNMEPDDWRWHFYDTVKGSDWLGDQDAI
HYMCREAPRAVLELENYGMPFSRTKEGKIYQRAFGGQSLDYGRGGQAHRTCCVADRTGHS
MLHTLYGRTLAYDCKYFIEYLALDLLMNKNRCVGVIAWNLEDGKLHRFHSNNTILATGGY
GRAYFSCTSAHTCTGDGTAMVSRAGLPNADMEFVQFHPTGIYGAGCLITEGVRGEGGYLI
NSKGERFMERYAPNAKDLASRDVVSRAMAIEIREGRGVGAQKDHIYLQLHHLPANLIHDR
LPGIAETAHIFAGVDCTKEPIPVLPTVHYNMGGIPTNHTAQVLTFKPGSGDQIIQGLYAA
GETAAHSVHGANRLGANSLLDLVIFGRACALTIAKTCKPGEKFPDLPANAGERSVANLDK
LRQANGTITVADLRLKMQKTMQEHASVFRTGEVLQEGCKKMEGIYKQLENVKLSDRGLIW
NTDLVEAIELQNLMLNAVQTINCAEARKESRGAHAREDFKQRIDEFDYSKPLDGQTKLPF
EKHWRKHSMVWMDEVTGRTRIEYRPVIDKTLDKAEVDWVQPKVSPADGVVQWCGKISDGV
LSQIKGITYHINDFFGQVEIPGIDFEDLKTNKKGMRHGSLSDLSYSPGYDTEKGRKMGDF
RLGSSVVLIFEAPADFHFSVSSGQRIKYGEMLGDINSQAYNLESS
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccaaactttccagtgtcaatgtcaatttgttgaagcgctgtttgttctttaac
cctcaagcttacagtagttatgaatcgcgaagatttgtttccggctatgaaatcgtagat
cacacatacgatgcggttatcgttggtgcaggaggagccgggctgagggctgcgatgggt
ttagtcgaggcgggattcaaaactgccgtagtgacaaaactttttccaacccgcagtcac
acagttgctgctcaaggcggtgtgaatgctgcactgggtaatatggaaccagacgattgg
cgttggcatttttacgacactgtgaaaggttctgattggttaggagaccaagatgcgatt
cattacatgtgtcgtgaagcaccaagggctgtgttggagttggaaaattacggcatgcca
ttcagtcgtactaaggaaggaaaaatatatcagagagcttttggtggtcaaagtctggac
tacggtcgtggtggtcaagcgcatcgtacgtgctgcgtggcggatcgaactggccatagc
atgttgcacacgctgtacggccgaacgttggcctacgattgcaaatattttattgaatat
ttggcgttggatcttttgatgaataagaatcgttgtgttggtgtgatcgcgtggaacttg
gaagatggaaaattgcatcgtttccacagtaacaatacaattttagccaccggtggttac
ggaagggcttacttcagttgcacatcagcgcacacgtgcactggcgatggaacggcaatg
gtttcgcgcgctggccttccgaacgcggacatggaatttgttcagtttcatccaacaggt
atatacggggctggctgtttgataacggaaggtgtgcgtggagagggtggatatttgatc
aatagcaaaggcgagcgcttcatggaacgttacgcaccgaatgcgaaagatctggcatct
cgggatgtggtgtcgcgtgctatggctattgaaattcgcgaaggtcgtggcgtcggtgct
cagaaagatcacatatacctgcagttgcatcatttgccggcaaatttgattcacgatcgt
ttgccaggcattgctgagacggcgcacatcttcgccggcgtcgactgcaccaaagaacca
attccagtattgcctacggttcattacaacatgggtgggatacctactaaccacactgcg
caggttttgacattcaagccgggtagcggtgatcaaataattcaaggtctttacgcggcc
ggtgaaacggctgcgcattccgtccacggtgccaaccgtctaggcgccaattcgttgttg
gatttggtcatctttggacgcgcttgcgctttgaccattgctaaaacttgcaagccgggc
gagaagtttccagatttgccagccaacgccggcgaacggtcggtggcaaatttggacaaa
ctccgacaagccaacggaaccatcactgtggcggatttgcgcttgaaaatgcaaaaaact
atgcaagagcatgctagcgtttttcgcactggggaagttttgcaagaaggatgtaagaaa
atggaaggcatttataaacagttggaaaatgtgaaattgtccgatcgtgggctgatatgg
aatacggatttggtcgaggcgattgaattgcaaaatttaatgctgaatgcggttcagacg
atcaattgtgccgaagctcgtaaagagagtcgtggtgcgcatgcccgtgaagatttcaaa
caacgtattgacgagttcgactattcgaagccattggatgggcaaacgaaattgccgttc
gaaaagcactggcgtaagcattcgatggtttggatggatgaagtgacgggtagaacaaga
atcgaataccgtccagtcattgacaaaactctcgacaaagctgaggtcgattgggtacag
ccgaaagtttctcctgccgacggtgttgttcagtggtgtggaaaaatctcagacggtgtg
cttagtcaaatcaaaggaatcacgtatcacataaatgatttctttggtcaagtggaaatt
cctggtattgattttgaagacttgaaaacgaacaaaaaaggaatgcgacatggctctctt
tctgatttgagttatagtccaggatatgatactgagaaaggtagaaaaatgggtgatttt
cgtctcggctctagtgttgttctcatctttgaagcccctgcagattttcacttcagcgtc
agttctggccagcgtattaaatacggcgaaatgctcggagatataaattcccaagcgtat
aatttggaaagcagttga

DBGET integrated database retrieval system