KEGG   Trichinella spiralis: Tsp_07635Help
Entry
Tsp_07635         CDS       T01609                                 

Definition
(RefSeq) phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
tsp  Trichinella spiralis
Pathway
tsp00562  Inositol phosphate metabolism
tsp01100  Metabolic pathways
tsp04068  FoxO signaling pathway
tsp04070  Phosphatidylinositol signaling system
tsp04140  Autophagy - animal
tsp04150  mTOR signaling pathway
tsp04212  Longevity regulating pathway - worm
tsp04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:tsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Tsp_07635
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    Tsp_07635
   04070 Phosphatidylinositol signaling system
    Tsp_07635
   04150 mTOR signaling pathway
    Tsp_07635
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Tsp_07635
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    Tsp_07635
  09149 Aging
   04212 Longevity regulating pathway - worm
    Tsp_07635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tsp01009]
    Tsp_07635
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Tsp_07635
    3.1.3.48  protein-tyrosine-phosphatase
     Tsp_07635
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     Tsp_07635
Protein phosphatases and associated proteins [BR:tsp01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    Tsp_07635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 PTPlike_phytase Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 10903532
NCBI-ProteinID: XP_003381091
LinkDB All DBs
Position
Unknown
AA seq 442 aa AA seqDB search
MSAITTTTTTTTTISIAFRLCKCRCYNAARFGNRVARYPFRDHHPPCLELMKPFCEDVDQ
WLNAGPNNVVAIHCKAGKGRTGVMICAYLLYISRFQTADEALHFYGQQRTIDMNGVTIPS
QRRYVDYFGQLVRDQFHYSTVRMALRCIEILNSPIMDKGGGFNPCFVVHCDKREIAKCFP
TEPSPRMSNRIVIMLPAHCIERLFHFWFNTFFLSTSESAISWRDYCSTLGYSFGEENVDD
IDSPLHELKLNIGELDAVKCKAQKLLTENFQVVVSMQRCADLDSEFSTNNSCPSMPTHVT
QKDSLSSVSDESDMSSTSAEQDEEWNLENNKNIQANKSDEKISSHQLAVGRHGDDTIASG
REHPAAREDSTSSSCSSTSKSLEACQAPQAPSLVKGDGNGSGTVSAATNDAAHAVVSSRQ
FGGVLVDEPDTSSTYLNVLVAR
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaatcaccaccaccaccaccaccaccaccactatcagcatagcatttcgtttg
tgcaagtgccgttgctacaatgcagccagatttggaaatcgtgttgctcgttatccattc
agggatcaccatcctccctgtttggaattgatgaaacctttctgcgaagacgtggatcag
tggctgaatgcagggccgaacaacgttgttgctattcattgcaaagctggcaaaggtcgg
acgggcgtcatgatttgtgcatatcttctttacatcagcaggtttcaaacagccgacgaa
gcgcttcatttttatggtcaacaacggacaatcgacatgaatggagtgacgattccaagc
cagaggagatatgtggattattttggacaactcgtgcgcgaccaattccactacagcaca
gtccgaatggcgttgcgttgcattgaaatattgaattcgccaattatggacaaagggggc
ggatttaatccttgttttgttgttcactgcgacaaacgggaaattgcgaaatgctttcca
accgaaccgtcaccccgtatgtccaatcggattgtcatcatgctgcctgcccattgtata
gaacgcctttttcatttttggttcaacaccttcttcctcagcacaagtgaatcagcgatc
tcttggcgtgactactgttctacactcgggtatagctttggtgaagagaacgtcgacgac
atcgactcgccgctgcacgagctgaaactgaatattggtgaacttgatgcagtgaagtgt
aaagcacagaaattgttaactgaaaattttcaagttgtggtttcgatgcaacgctgtgca
gatttggactcggaattcagtacgaacaacagttgtccttccatgcctacgcatgttacc
cagaaggattctttgagttcggtcagcgacgaatcggacatgagttcgacttcagctgag
caagacgaagaatggaacctcgagaacaacaagaacattcaagccaacaaaagtgacgag
aaaatttcttcccatcaacttgctgttggtcgtcatggcgacgacactattgcttctggt
agagaacatccagcagctagagaagactcgacatcgtcgtcgtgttcgtcgacgtcgaaa
agtttggaagcttgccaagcgccgcaggcaccctcgctggtcaagggtgacggcaatgga
agtggaactgtaagtgctgcaacaaacgatgctgcgcatgcagtagtatcatctaggcag
ttcggtggtgttcttgtggacgaaccggacacatcttccacctacttaaacgtgctggtc
gcgcgctga

DBGET integrated database retrieval system