KEGG   Trichinella spiralis: Tsp_11103Help
Entry
Tsp_11103         CDS       T01609                                 

Definition
(RefSeq) putative copper/zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
tsp  Trichinella spiralis
Pathway
tsp04146  Peroxisome
tsp04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:tsp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Tsp_11103
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Tsp_11103
Enzymes [BR:tsp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Tsp_11103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 10902322
NCBI-ProteinID: XP_003382001
UniProt: E5RZT8
LinkDB All DBs
Position
Unknown
AA seq 180 aa AA seqDB search
MLAIPALSEFHHKCLCDCVDFCFRMPFKAICVIRGENVTGTVTFKQNTEDDKTFITGEIK
GLTPGKHGFHVHEWGDNSMGCISAGAHYNPFGKTHGGPTDTVRHVGDLGNILAGSDGVAK
IDIADDQIKLTGAHSVIGRTMVVHIQEDDLGKGGDDESLKTGNAGARVGCGVIGIANPAA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccatccccgctttgagtgaatttcatcataaatgcttatgtgattgtgttgat
ttctgtttcagaatgccgtttaaagcaatttgtgtaattcgtggtgaaaatgttactggt
actgtgaccttcaaacagaacacggaagatgataaaacattcatcactggagaaataaaa
ggcttgactcctggaaaacatggatttcacgttcatgaatggggtgataatagcatgggt
tgcatttctgctggtgctcactacaatccatttggtaaaactcacggtggacccaccgat
actgtacgtcatgtgggagatttgggcaatatcttggccggttcagatggtgttgcaaaa
attgacatagcagacgatcagatcaaactgacaggtgcacattcagtaattggtcgcact
atggtagtgcatattcaagaagatgatttgggaaaaggaggtgatgacgaaagcctgaaa
actggaaatgctggagcacgtgttggatgtggagtaatcggtattgcaaatccagctgct
tga

DBGET integrated database retrieval system