KEGG   Thamnophis sirtalis: 106541153
Entry
106541153         CDS       T06107                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04068  FoxO signaling pathway
tsr04217  Necroptosis
tsr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106541153 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106541153 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106541153 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tsr03000]
    106541153 (STAT3)
Transcription factors [BR:tsr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    106541153 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Baculo_PEP_C Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 106541153
NCBI-ProteinID: XP_013911982
UniProt: A0A6I9XDP3
LinkDB
Position
Unknown
AA seq 772 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEENRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKTLVDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPLLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGEVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEATDPGSAAPYLKTKFICVTPTTCS
STIELPMSPRTLESLIHFGSNGEGADGNASGQFESLQVFDMEMTAECANSPM
NT seq 2319 nt   +upstreamnt  +downstreamnt
atggcacagtggaaccaactgcagcaattggacacaagatacttggagcagctccaccag
ctttacagtgacagctttccaatggaacttcggcagttccttgcaccttggatagagagc
caggattgggcttatgctgccagcaaagagtctcatgctactttggtatttcataatctt
ctgggtgaaattgaccagcagtacagtcgcttcctacaagaatccaatgttctctatcag
cataatctacgccggatcaaacagttcctacagagcagatatctggagaaacccatggag
attgctcgcattgtagcccgttgtctctgggaagagaatcggctgctacagacagcagca
acagcagcacagcaaggtggtcaggcaaaccaccctacagctgctgtagtgacagagaaa
cagcagatgctggaacaacacttgcaagatgttagaaagcgcgtccaggatctggagcag
aagatgaaagtggtggagaacctgcaggatgattttgattttaattataagactttgaag
agtcaaggtgatatgcaggatctgaatggaaacaaccagtcagtgacacgccagaagatg
caacagctggagcaaatgctaactgcactggatcaaatgcgaagggggattgtgagtgaa
ctggctgggctcttatctgccatggaatatgtgcagaaaacattagtggatgaggaactg
gctgattggaagaggagacagcagattgcatgtattggtggaccacccaacatctgccta
gatcgtctggagaactggataacatccttggctgagtcacaacttcaaacacgtcagcag
attaagaaacttgaggagctgcagcagaaggtctcctacaagggggacccaattgttcaa
caccggccattgctggaagagcgtattgtggaattattcaggaatctcatgaagagtgct
tttgtggtcgagcggcagccctgtatgccaatgcatccagatcgtccacttgttatcaaa
actggagtacaatttacaacaaaagtacggttactggttaagtttccagagctgaattat
cagctgaaaatcaaagtttgcattgacaaggattctggtgaagtggctgcccttcgggga
tcccggaagtttaatatcttgggaacaaatactaaggtgatgaacatggaggagtccaac
aatggaagcctttctgcagaattcaaacatttgacactgagagagcagagatgtggtaat
ggtggaagagccaattgtgatgcttctctcatcgtcacagaagaactccatcttattaca
tttgagacagaagtttaccaccaaggtttgaaaattgacctggagacccattcacttcca
gtagtggtgatctccaacatttgccagatgccaaatgcatgggcatccattttgtggtac
aacatgctgacaaataatcccaagaacgtgaactttttcacaaagccacccattggcaca
tgggatcaagttgctgaggtgctcagctggcagttctcctcaaccaccaaacggggactc
agcatagaacagttgacgactcttgccgaaaagctacttggacctggtgtcaattactct
ggatgccaaataacatgggccaaattctgcaaggagaacatggcaggaaaaggcttttca
ttctgggtgtggctggacaatataattgacctagtgaagaagtacatcttggcactttgg
aatgaaggatatatcatgggcttcatcagcaaagagagggaaagagccatcctgagcaca
aagcctccaggaacctttttgttgcgtttcagcgaaagcagcaaggaaggtggaatcact
ttcacatgggtggagaaagatattagtggaaaaacacaaattcagtctgtggagccatac
accaagcaacaactcaataacatgtcatttgctgagattattatgggttacaagatcatg
gatgctaccaacatcctggtttccccacttgtttatttgtaccctgatattcctaaagaa
gaggcctttggaaaatactgccgtcctgagagccaggagcatcctgaagccactgaccca
ggtagcgctgctccgtatctgaagactaagttcatctgtgtaactccaacaacctgcagt
agcactattgaactacccatgtctccccgcacacttgaatccctgatccattttggcagt
aatggtgaaggagctgatggaaatgccagtgggcagtttgagtccttgcaggtgttcgac
atggagatgactgctgaatgtgccaattcacccatgtga

DBGET integrated database retrieval system