KEGG   Thamnophis sirtalis: 106541210
Entry
106541210         CDS       T06107                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04012  ErbB signaling pathway
tsr04068  FoxO signaling pathway
tsr04110  Cell cycle
tsr04115  p53 signaling pathway
tsr04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106541210 (CDKN1A)
   04068 FoxO signaling pathway
    106541210 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106541210 (CDKN1A)
   04115 p53 signaling pathway
    106541210 (CDKN1A)
   04218 Cellular senescence
    106541210 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106541210
NCBI-ProteinID: XP_013912060
UniProt: A0A6I9XMS1
LinkDB
Position
Unknown
AA seq 149 aa
MPLSESKILQPSCSRKLCRNLFGPVDHEQLQKDFQSLMKVQLEEAQQKWNFDFETETPLE
GNYKWEKVSHLNMLPSPDLLEHTKENSCTGEKSRSPPALFKRHTKTERPGQVGLEACKAD
SPRCLKRKQTSIKDFYGSKRRTSPYKPKP
NT seq 450 nt   +upstreamnt  +downstreamnt
atgcctctttctgagagtaaaatccttcaaccttcctgcagcaggaaactctgcagaaat
ctctttggaccggttgatcatgaacagctccagaaggactttcagtccttgatgaaggtc
cagctggaagaagcccagcaaaagtggaactttgactttgaaacagaaaccccactggaa
gggaattacaaatgggaaaaggtctctcatctaaatatgctgccatctccagatctcttg
gaacacacaaaggaaaacagctgtacaggggaaaagagccggagtcctccagcactcttc
aagaggcacacaaagacagaaagaccagggcaggtgggccttgaagcttgtaaggctgat
tcccccagatgtttgaaaagaaagcagacaagtatcaaagacttttatggttcaaagcga
cgaactagcccatataagccaaagccatga

DBGET integrated database retrieval system