KEGG   Thamnophis sirtalis: 106542214
Entry
106542214         CDS       T06107                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106542214 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tsr04052]
    106542214 (EPO)
Cytokines and growth factors [BR:tsr04052]
 Cytokines
  CSF and other factors
   106542214 (EPO)
SSDB
Motif
Pfam: EPO_TPO QH-AmDH_gamma
Other DBs
NCBI-GeneID: 106542214
NCBI-ProteinID: XP_013913355
UniProt: A0A6I9Y5Q5
LinkDB
Position
Unknown
AA seq 146 aa
MNKFIQDASRMEKDVVDLCEDACNLPEQVTVSDTRVNFPDWRAMDRSRQAWEVWSGQALL
SSAVGQVKSQQPRMQPFLRQLEVMESGLRSIREILRRHNAQAGPAEEPLPRTLSVPTVPK
LFSVYASFLRGKVNLFLASVCQGSGR
NT seq 441 nt   +upstreamnt  +downstreamnt
atgaacaaattcatccaggacgccagcaggatggagaaggacgttgtggacctttgcgaa
gacgcctgcaacttacctgaacaggtgacggtgtcggacacgcgggtgaattttccggac
tggcgagcaatggacaggtccaggcaggcctgggaggtgtggagtggccaggcgcttctc
tccagcgccgtcggccaagtgaaaagccagcagccgcggatgcagcctttccttcgccag
ctggaagtgatggagagcgggttgaggagcatccgagagattctgcgcaggcacaatgcc
caggcaggccccgcggaggagcccctccctcggacgttgagcgtgcccactgtgccaaaa
ctcttcagcgtctatgccagcttcctgcgggggaaggtcaatttattcctcgccagcgtg
tgccagggaagtggcaggtga

DBGET integrated database retrieval system