KEGG   Thamnophis sirtalis: 106542384
Entry
106542384         CDS       T06107                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
tsr  Thamnophis sirtalis
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 DUF5663 C1_2
Other DBs
NCBI-GeneID: 106542384
NCBI-ProteinID: XP_013913570
UniProt: A0A6I9Y5Y9
LinkDB
Position
Unknown
AA seq 372 aa
MNRPTHQEMIELQNLGLEEQLDLTRCPRGTANRPVRLERANALRISPGKVPELLTRVRQI
RLLGGQSDPKLTEELGEGHLFRSCTQSQPTWCDLCGEFIWGVFKKHLRCIYCKFICHYRC
RALIRLDCRGPRYKNEQDEGNEQTIEKDTNVDEQIDWEKPILSQADIEQKIKEYNSQINS
NLFMSLNKDGSYTGFIKVQLKLIRPVSVPANKKAPSIQDTKKSSLRSQSVKRRTSFYLPK
NTIKHLHIISRTRAGEVIEALLKKFMVVDNPRKFALFERTEKDDQVYIRKLSDEEQPLRI
RLLAGPNEKTLSFVLKENETGEVNWDAFSMPELQNFLRILQREEEEHTRQILQKYAHCRQ
KMQEALAARTPG
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgaaccgtcccacgcaccaagagatgatcgaactgcagaacctgggcctggaggagcag
ctggacctgacgcgctgcccgcgaggcacggccaaccgccccgtccgcttagagcgcgcc
aacgccttgaggatctctcccgggaaggtgcccgagcttttgacccgcgttcgccagatc
cgccttctgggcggccagagcgatcctaaattaaccgaggagctcggcgagggacacctc
ttccgatcctgcactcagagtcaacccacctggtgcgatctgtgcggggagttcatctgg
ggcgtcttcaaaaagcatctccgctgcatctactgcaagttcatctgtcactaccgatgc
cgtgctctaatccgacttgattgcaggggacccagatataaaaatgagcaggatgaaggc
aatgagcagacaatagaaaaagacactaatgtggatgaacagattgactgggagaaaccc
attctgtcccaggctgacattgaacaaaagataaaagaatataatagccagataaacagt
aacctctttatgagtttgaataaagatgggtcctatactggcttcattaaggtacaacta
aagctgatccggcctgtgtcagtacctgccaataagaaagcaccctcaatccaggacact
aagaagagttcgttgcgcagccaatctgtaaaacgccgaacttcattctacttaccaaag
aatacaatcaaacatctacatataatttctcgtacacgggccggtgaagtcattgaagcc
ctgctcaagaaatttatggttgttgacaatccccgcaaatttgccctctttgaaagaaca
gaaaaagatgaccaagtatatatccgtaagctttctgatgaggaacaacccctgcgtatc
cgactacttgctggtcctaatgaaaaaacactcagttttgttctgaaggaaaatgagact
ggtgaagtcaattgggatgcctttagcatgcctgaattgcagaattttctgcgtatcctg
cagcgtgaagaagaggagcatactcggcagattctgcagaaatatgcccattgtcgccaa
aaaatgcaagaggctctagctgctcgcaccccaggttga

DBGET integrated database retrieval system