KEGG   Thamnophis sirtalis: 106542615
Entry
106542615         CDS       T06107                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04010  MAPK signaling pathway
tsr04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106542615 (TGFA)
   04012 ErbB signaling pathway
    106542615 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 hEGF DUF1180 TMEM154 Insulin_TMD Syndecan EphA2_TM UPF0560
Other DBs
NCBI-GeneID: 106542615
NCBI-ProteinID: XP_013913869
UniProt: A0A6I9XE14
LinkDB
Position
Unknown
AA seq 137 aa
MIVRSLATGCPPVAAAVRSHFNNCPDAHSSFCFHGTCRFLVQEEEPTCVCHSGYIGARCE
HADLLAVVSAAQKKQTITALVVVSIVASIVLVVVCVLIHCCRIRKHCEWCRAMVCRHEKP
TGLLKGATSCCHSETVV
NT seq 414 nt   +upstreamnt  +downstreamnt
atgattgtcaggagcctggcaactggctgtcccccggtggcagctgcagtgagatcccac
tttaacaactgtccagatgcccacagttccttttgcttccatgggacgtgcagattcctg
gtgcaagaagaagaaccgacctgcgtgtgccactctgggtacataggagcccgctgtgag
cacgctgacctcctggcggtggtttctgctgcccagaagaagcaaaccataaccgctttg
gtggtggtttccatcgtcgcctccattgtgctggtcgtggtctgcgtcctgatacattgc
tgcaggatacggaagcactgcgagtggtgcagagcaatggtttgccggcatgagaaaccc
accgggctgctgaagggggccacgtcttgctgccactcagagacagttgtctga

DBGET integrated database retrieval system